CATH Domain: 1z1bA01 XML data for domain: 1z1bA01

Molscript image for 1z1bA01
1z1bA01
PDB coordinates for domain 1z1bA01

PDB 1z1b, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.160 Double Stranded RNA Binding Domain
3.30.160.60 Classic Zinc Finger Gene3D
3.30.160.60.20
3.30.160.60.20.1
3.30.160.60.20.1.1
3.30.160.60.20.1.1.1
3.30.160.60.20.1.1.1.1

[top]
Segment boundaries for domain 1z1bA01

Chopping figure for domain 1z1bA01
DomainStart PDB ResidueStop PDB Residue
1z1bA01 8 64
1z1bA02 74 174
1z1bA03 177 355

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1z1bA01
ERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGHKHKPL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1z1bA01
MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGHKHKPL
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 15 Dec 2006 19:33

Assigning to "3.30.160.60" based on similarity with "1kjkA00"

Flow stage update by auto on 15 Dec 2006 19:32

No in_process hits for Domain "1z1bA01" ready to be processed

Update comment by auto on 15 Dec 2006 15:39

Domain "1z1bA01" hits Domain "1z1bB01" (100% over 100%) which is currently in process

Flow stage update by auto on 15 Dec 2006 15:36

Domain "1z1bA01" hits Domain "1z1bB01" (100% over 100%) which is currently in process

Flow stage update by auto on 15 Dec 2006 15:36

NW result present for Domain "1z1bA01"

Flow stage update by auto on 14 Dec 2006 15:49

All required files are present for Domain "1z1bA01"

Flow stage update by auto on 13 Dec 2006 19:36

Beginning processing for Domain "1z1bA01"

Insertion by auto on 13 Dec 2006 19:26

Final ChopClose added based on similarity with "1z1bB"