Domain assigned by auto on 28 Apr 2006 21:03
Assigning to "2.60.200.30" based on similarity with "1suwA02" (NWSI: 100, NWO: 100, SPS: 98.01, SPO: 100, RMSD: 0.28)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1z0sA01 | 1 | 101 |
| 1z0sA01 | 227 | 249 |
| 1z0sA02 | 102 | 226 |
There are 1 matching structural neighberhood comparisons for CATH ID 2.60.200.30.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2an1A02 | 90.92 | 2.60.200.30 | 130 | 26 | 96 | 1.62 | 1.68 |
>pdb|1z0sA02 RVSCSAMPDVLALNEIAVLSRKPAKMIDVALRVDGVEVDRIRCDGFIVATQIGSTGYAFSAGGPVVEPYLECFILIPIAP FRFGWKPYVVSMERKIEVIAEKAIVVADGQKSVDFDGEITIEKSE
Assigning to "2.60.200.30" based on similarity with "1suwA02" (NWSI: 100, NWO: 100, SPS: 98.01, SPO: 100, RMSD: 0.28)
NW result present for Domain "1z0sA02"
All required files are present for Domain "1z0sA02"
Beginning processing for Domain "1z0sA02"