CATH Domain: 1yydA01 XML data for domain: 1yydA01

Molscript image for 1yydA01
1yydA01
PDB coordinates for domain 1yydA01

PDB 1yyd, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.520 Peroxidase; domain 1
1.10.520.10 Gene3D
1.10.520.10.3
1.10.520.10.3.1
1.10.520.10.3.1.1
1.10.520.10.3.1.1.1
1.10.520.10.3.1.1.1.1

[top]
Segment boundaries for domain 1yydA01

Chopping figure for domain 1yydA01
DomainStart PDB ResidueStop PDB Residue
1yydA01 11 141
1yydA01 273 300
1yydA02 142 272
1yydA02 302 342

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.520.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1c8iA01 89.56 Peroxidase'Arthromyces ramosus' 1.10.520.10 193 42 80 1.14 1.42
2vcnA01 86.36 Ascorbate peroxidaseGlycine max 1.10.520.10 141 27 83 2.25 2.69
1itkA01 83.44 Haloarcula marismortuiCatalase-peroxidase 2 1.10.520.10 142 22 83 2.96 3.57
1mwvA03 77.29 Catalase/peroxidase [EC:1.11.1.6 1.11.1.7]Burkholderia pseudomalleiMethane metabolismCatalase-peroxidasePhenylalanine metabolism 1.10.520.10 181 15 72 3.63 4.98
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1yydA01
HAACCAFIPLAQDLQETIFQNECGEDAHEVIRLTFHDAIAISRSQGPKAGGGADGSMLLFPTVEPNFSANNGIDDSVNNL
IPFMQKHNTISAADLVQFAGAVALSNCPGAPRLEFLAGRPNKTIAAVDGLIMSKLAVLGHNRNSLIDCSDVVPVPKPAT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1yydA01
HAACCAFIPLAQDLQETIFQNECGEDAHEVIRLTFHDAIAISRSQGPKAGGGADGSMLLFPTVEPNFSANNGIDDSVNNL
IPFMQKHNTISAADLVQFAGAVALSNCPGAPRLEFLAGRPNKTIAAVDGLIMSKLAVLGHNRNSLIDCSDVVPVPKPAT
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:01

Assigning to "1.10.520.10" based on similarity with "1mn1001" (NWSI: 100, NWO: 100, SPS: 98.59, SPO: 100, RMSD: 0.18)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "1yydA01"

Flow stage update by auto on 28 Apr 2006 17:48

All required files are present for Domain "1yydA01"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "1yydA01"

Insertion by auto on 10 Mar 2006 05:58

Final ChopClose added based on similarity with "1mnp0" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 97.47, SI: 100, SO: 100]