Classification merge by cuff on 27 Jun 2008 16:09
COMMENT: High SSAP score. Definitely same architecture likely same fold. 2.40 beta barrel, 2.30 roll. 2gjgA02 gap in barrel - move to 2.30.110 ? FINAL: move 1ywuA00 to 2.40.10.220
CATH Domain: 1ywuA00
1ywuA00
PDB 1ywu, Chain A, Domain 0
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|1ywuA00 MSDQHDERRRFHRIAFDADSEILQGERRWEVLLHDVSLHGILVGQPQDWNGDPQRPFEARLYLGLDVLIRMEISLAWARD GLLGFECQHIDLDSISHLRRLVELNLGDEELLERELALLVSAHDD
Domain History Events (78)
Domain assigned by cuff on 07 Feb 2008 12:58
not enough evideence to assign to a superfamily
Domain assignment manual match t by cuff on 07 Feb 2008 12:53
Having taken a close look and taken note of the SCOP results I believe the query to be in the 2.30.110 fold group. But there is not enough functional evidence to place it in a existing superfamily
Domain assignment manual match t by tronnberg on 07 Sep 2007 09:27
SSAP: 73.02 OV: 73 SEQ: 7. Reasonable similar linkage and structure. The function for the query is unknown.
Homcheck review by tronnberg on 07 Sep 2007 09:27
SSAP: 73.02 OV: 73 SEQ: 7. Reasonable similar linkage and structure. The function for the query is unknown.
Flow stage update by tronnberg on 07 Sep 2007 09:27
SSAP: 73.02 OV: 73 SEQ: 7. Reasonable similar linkage and structure. The function for the query is unknown.
Homcheck allotment by tronnberg on 07 Sep 2007 09:24
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by tronnberg on 07 Sep 2007 09:24
User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 07 Sep 2007 02:02
Domain "1ywuA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 07 Sep 2007 02:01
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 1ywuA00
Flow stage update by auto on 06 Sep 2007 23:41
Retrieved PRC_PFAMCATH results for job ID SID7076133136139488 and results inserted.
Domain scan prc pfamcath by auto on 06 Sep 2007 23:40
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2 results for 1ywuA00
Update comment by auto on 06 Sep 2007 05:12
PRC_PFAMCATH job SID7076133136139488 is not yet finished.
Flow stage update by auto on 06 Sep 2007 05:08
The entry "1ywuA00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 06 Sep 2007 05:08
The entry "1ywuA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 06 Sep 2007 02:44
Retrieved SSAP results for job ID SID0885621501623136 and results inserted.
Domain scan ssap cath by auto on 06 Sep 2007 02:40
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2083 results for 1ywuA00
Update comment by auto on 05 Sep 2007 19:09
SSAP job SID0885621501623136 is not yet finished.
Ssap cath submit by auto on 05 Sep 2007 15:34
The entry "1ywuA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 15:34
The entry "1ywuA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 05 Sep 2007 04:50
Retrieved PRC results for job ID SID3342360429298204 and inserted them into the database.
Domain scan prc cath by auto on 05 Sep 2007 04:50
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 1ywuA00
Flow stage update by auto on 04 Sep 2007 13:38
The entry "1ywuA00" has been submitted to the PRC webservice.
Prc cath submit by auto on 04 Sep 2007 13:38
The entry "1ywuA00" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Sep 2007 10:48
Retrieved HMM(SAM) results for job ID SID2838166578582432 and inserted them into the database.
Domain scan sam cath by auto on 04 Sep 2007 10:47
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 1ywuA00
Sam cath submit by auto on 04 Sep 2007 09:25
The entry "1ywuA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Sep 2007 09:25
The entry "1ywuA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 03 Sep 2007 20:25
Retrieved "1ywuA00" CATHEDRAL results for job ID SID6964840086903136 and inserted them into the database.
Domain scan cathedral cath by auto on 03 Sep 2007 20:24
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 26 results for 1ywuA00
Cathedral cath submit by auto on 03 Sep 2007 13:35
The entry "1ywuA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 13:35
The entry "1ywuA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Sep 2007 11:26
ScanList with 11099 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1ywuA00.scanlist" for "1ywuA00"
Write scan list by auto on 03 Sep 2007 11:26
Writing ScanList containing 11099 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1ywuA00.scanlist" for domain "1ywuA00"
Update comment by auto on 03 Sep 2007 10:10
Waiting for 18 new domains (example : 2qg4C01) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 06:30
Waiting for 73 new domains (example : 2q3eK03) to be processed so that they can be scanned against too.
Update comment by auto on 03 Sep 2007 02:35
Waiting for 140 new domains (example : 2q08A02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 22:31
Waiting for 188 new domains (example : 2o3jA01) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 18:19
Waiting for 279 new domains (example : 2b43C04) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 14:19
Waiting for 351 new domains (example : 1sh0B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 10:13
Waiting for 431 new domains (example : 1r0kA03) to be processed so that they can be scanned against too.
Update comment by auto on 02 Sep 2007 02:25
Waiting for 551 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 22:10
Waiting for 607 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 18:12
Waiting for 686 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 14:13
Waiting for 771 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 11:39
Waiting for 841 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 06:12
Waiting for 903 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 01 Sep 2007 03:29
Waiting for 969 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 31 Aug 2007 20:03
Waiting for 1085 new domains (example : 1bplB01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 16:14
Waiting for 1046 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 10:10
Waiting for 1038 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 06:30
Waiting for 1087 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 30 Aug 2007 02:34
Waiting for 1146 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 22:14
Waiting for 1197 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 14:41
Waiting for 1257 new domains (example : 1bo5O01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 09:03
Waiting for 1140 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Aug 2007 02:20
Waiting for 1202 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 22:27
Waiting for 1261 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 18:31
Waiting for 1343 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 14:48
Waiting for 1412 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 10:12
Waiting for 1494 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 08:09
Waiting for 1549 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Aug 2007 02:18
Waiting for 1622 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 22:19
Waiting for 1678 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 18:12
Waiting for 1755 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 14:12
Waiting for 1834 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 10:24
Waiting for 1921 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 06:30
Waiting for 1975 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Aug 2007 02:22
Waiting for 2046 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Aug 2007 22:18
Waiting for 2103 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Aug 2007 18:24
Waiting for 2173 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Aug 2007 14:22
Waiting for 2242 new domains (example : 1ii8B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 26 Aug 2007 14:21
No satisfactory AssignClose result found.
Flow stage update by auto on 26 Aug 2007 14:09
No in_process hits for Domain "1ywuA00" ready to be processed
Flow stage update by auto on 26 Aug 2007 14:09
NW result present for Domain "1ywuA00"
Flow stage update by auto on 19 Aug 2007 10:11
All required files are present for Domain "1ywuA00"
Flow stage update by auto on 18 Aug 2007 14:31
Beginning processing for Domain "1ywuA00"
Insertion by cuff on 18 Aug 2007 13:26
nice chopping
