CATH Domain: 1yumA00 XML data for domain: 1yumA00

Molscript image for 1yumA00
1yumA00
PDB coordinates for domain 1yumA00

PDB 1yum, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.620 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1 Gene3D
3.40.50.620.7
3.40.50.620.7.1
3.40.50.620.7.1.1
3.40.50.620.7.1.1.1
3.40.50.620.7.1.1.1.1

[top]
Segment boundaries for domain 1yumA00

Chopping figure for domain 1yumA00
DomainStart PDB ResidueStop PDB Residue
1yumA00 2 213

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.40.50.620.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nupB00 86.27 Nicotinate-nucleotide adenylyltransferase activityHomo sapiensMitochondrionNicotinamide mononucleotide adenylyltransferase 3 3.40.50.620 212 23 93 2.61 2.79
1kamA00 85.65 Bacillus subtilisNicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]Nicotinate and nicotinamide metabolismNicotinate-nucleotide adenylyltransferaseMetabolic pathways 3.40.50.620 180 34 84 2.88 3.39
3h05A00 82.98 Putative uncharacterized protein VPA0413Nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]Vibrio parahaemolyticusNicotinate and nicotinamide metabolismMetabolic pathways 3.40.50.620 152 19 70 2.09 2.95
3k9wA00 79.32 Pantothenate and CoA biosynthesisMetabolic pathwaysPhosphopantetheine adenylyltransferasePantetheine-phosphate adenylyltransferase [EC:2.7.7.3]Burkholderia pseudomallei 1710b 3.40.50.620 154 16 70 2.77 3.94
1ej2A00 78.30 Methanothermobacter thermautotrophicus str. Delta HNicotinamide-nucleotide adenylyltransferase 3.40.50.620 167 16 71 3.52 4.94
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1yumA00
GKRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVSAAQRLAMVERAVAGVERLTVDPRELQRDK
PSYTIDTLESVRAELAADDQLFMLIGWDAFCGLPTWHRWEALLDHCHIVVLQRPDADSEPPESLRDLLAARSVADPQALK
GPGGQITFVWQTPLAVSATQIRALLGAGRSVRFLVPDAVLNYIEAHHLYRAP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1yumA00
GKRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVSAAQRLAMVERAVAGVERLTVDPRELQRDK
PSYTIDTLESVRAELAADDQLFMLIGWDAFCGLPTWHRWEALLDHCHIVVLQRPDADSEPPESLRDLLAARSVADPQALK
GPGGQITFVWQTPLAVSATQIRALLGAGRSVRFLVPDAVLNYIEAHHLYRAPHLEHHHHHH
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 15 Aug 2007 03:27

Assigning to "3.40.50.620" based on similarity with "1yunB00"

Flow stage update by auto on 15 Aug 2007 03:17

No in_process hits for Domain "1yumA00" ready to be processed

Update comment by auto on 15 Aug 2007 02:35

Domain "1yumA00" hits Domain "1yumB00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 01:27

Domain "1yumA00" hits Domain "1yumC00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 00:00

Domain "1yumA00" hits Domain "1yumD00" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:47

Domain "1yumA00" hits Domain "1yunB00" (100% over 100%) which is currently in process

Flow stage update by auto on 20 Jul 2007 10:57

Domain "1yumA00" hits Domain "1yulA00" (98.1900452488688% over 100%) which is currently in process

Flow stage update by auto on 20 Jul 2007 10:57

NW result present for Domain "1yumA00"

Flow stage update by auto on 16 Jul 2007 22:37

All required files are present for Domain "1yumA00"

Flow stage update by auto on 14 Jul 2007 17:56

Beginning processing for Domain "1yumA00"

Insertion by auto on 14 Jul 2007 16:15

Final ChopClose added based on similarity with "1yumC"