CATH Domain: 1yuaA02 XML data for domain: 1yuaA02

Molscript image for 1yuaA02
1yuaA02
PDB coordinates for domain 1yuaA02

PDB 1yua, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.10 Gene3D
2.20.25.10.17
2.20.25.10.17.1
2.20.25.10.17.1.1
2.20.25.10.17.1.1.1
2.20.25.10.17.1.1.1.1

[top]
Segment boundaries for domain 1yuaA02

Chopping figure for domain 1yuaA02
DomainStart PDB ResidueStop PDB Residue
1yuaA01 1 64
1yuaA02 65 122

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.20.25.10.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2napA01 75.94 Nitrogen metabolismDesulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774Periplasmic nitrate reductasePeriplasmic nitrate reductase NapA [EC:1.7.99.4] 2.20.25.90 58 12 72 3.08 4.25
2iv2X01 75.19 Methane metabolismMetabolic pathwaysGlyoxylate and dicarboxylate metabolismFormate dehydrogenase HFormate dehydrogenase, alpha subunit [EC:1.2.1.2] 2.20.25.90 55 9 68 3.29 4.77
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1yuaA02
PEKLRYLADAPQQDPEGNKTMVRFSRKTKQQYVSSEKDGKATGWSAFYVDGKWVEGKK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1yuaA02
PEKLRYLADAPQQDPEGNKTMVRFSRKTKQQYVSSEKDGKATGWSAFYVDGKWVEGKK
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1yua002" to "1yuaA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:52

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"