CATH Domain: 1ysqA00 XML data for domain: 1ysqA00

Molscript image for 1ysqA00
1ysqA00
PDB coordinates for domain 1ysqA00

PDB 1ysq, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.40 Gene3D
3.30.450.40.6
3.30.450.40.6.1
3.30.450.40.6.1.1
3.30.450.40.6.1.1.1
3.30.450.40.6.1.1.1.1

[top]
Segment boundaries for domain 1ysqA00

Chopping figure for domain 1ysqA00
DomainStart PDB ResidueStop PDB Residue
1ysqA00 5 191

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.450.40.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ia2A02 90.05 Rhodococcus sp. DK17PcaR 3.30.450.40 179 25 95 3.03 3.17
2o0yB02 86.58 Rhodococcus jostii RHA1Transcriptional regulator 3.30.450.40 176 21 92 3.62 3.90
3d3oA00 83.93 Putative transcriptional regulator (IcIR family)Acinetobacter sp. ADP1 3.30.450.40 167 19 90 3.33 3.68
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ysqA00
SLNIIHIAAPHLEALNIATGETINFSSREDDHAILIYKLEPTTGMLRTRAYIGQHMPLYCSAMGKIYMAFGHPDYVKSYW
ESHQHEIQPLTRNTITELPAMFDELAHIRESGAAMDREENELGVSCIAVPVFDIHGRVPYAVSISLSTSRLKQVGEKNLL
KPLRETAQAISNELGFTAITG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ysqA00
GHMALSSLNIIHIAAPHLEALNIATGETINFSSREDDHAILIYKLEPTTGMLRTRAYIGQHMPLYCSAMGKIYMAFGHPD
YVKSYWESHQHEIQPLTRNTITELPAMFDELAHIRESGAAMDREENELGVSCIAVPVFDIHGRVPYAVSISLSTSRLKQV
GEKNLLKPLRETAQAISNELGFTVRDDLGAITG
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 12 Jul 2007 00:03

Assigning to "3.30.450.40" based on similarity with "1yspA00"

Flow stage update by auto on 12 Jul 2007 00:02

No in_process hits for Domain "1ysqA00" ready to be processed

Flow stage update by auto on 12 Jul 2007 00:02

NW result present for Domain "1ysqA00"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "1ysqA00"

Flow stage update by auto on 06 Jul 2007 14:25

Beginning processing for Domain "1ysqA00"

Insertion by cuff on 06 Jul 2007 13:51

nice chopping