CATH Domain: 1yspA00 XML data for domain: 1yspA00

Molscript image for 1yspA00
1yspA00
PDB coordinates for domain 1yspA00

PDB 1ysp, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.40 Gene3D
3.30.450.40.4
3.30.450.40.4.1
3.30.450.40.4.1.1
3.30.450.40.4.1.1.1
3.30.450.40.4.1.1.1.1

[top]
Segment boundaries for domain 1yspA00

Chopping figure for domain 1yspA00
DomainStart PDB ResidueStop PDB Residue
1yspA00 1 172

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.30.450.40.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ia2A02 89.39 Rhodococcus sp. DK17PcaR 3.30.450.40 179 32 88 1.68 1.89
1ysqA00 89.13 Specific transcriptional repressor activityNegative regulation of transcription, DNA-dependentHTH-type transcriptional regulator yiaJEscherichia coli K-12 3.30.450.40 181 36 88 1.77 1.99
2o0yB02 86.47 Rhodococcus jostii RHA1Transcriptional regulator 3.30.450.40 176 27 88 2.95 3.35
3bjnA00 85.98 Transcriptional regulator, putativeVibrio cholerae 3.30.450.40 151 18 84 2.04 2.42
3d3oA00 84.93 Putative transcriptional regulator (IcIR family)Acinetobacter sp. ADP1 3.30.450.40 167 15 90 3.31 3.66
3e0yA00 78.48 Conserved domain proteinGeobacter sulfurreducens 3.30.450.40 153 11 74 3.69 4.95
2qybA00 78.03 Membrane protein, putativeGeobacter sulfurreducens 3.30.450.40 147 10 75 3.75 4.99
3eeaA00 77.71 GAF domain/HD domain proteinGeobacter sulfurreducens 3.30.450.40 153 10 75 3.32 4.38
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1yspA00
MDLIRSADIQMRELSRLTKETIHLGALDEDSIVYIHKIDSMIGRRNPLYSTAIGKVLLAWRDRDEVKQILEGVEYKRSTE
RTITSTEALLPVLDQVREQGYGEDNEEQEEGLRCIAVPVFDRFGVVIAGLSISFPTLRFSEERLQEYVAMLHTAARKISA
QMGY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1yspA00
GHMDLIRSADIQMRELSRLTKETIHLGALDEDSIVYIHKIDSMYNLRMYSRIGRRNPLYSTAIGKVLLAWRDRDEVKQIL
EGVEYKRSTERTITSTEALLPVLDQVREQGYGEDNEEQEEGLRCIAVPVFDRFGVVIAGLSISFPTLRFSEERLQEYVAM
LHTAARKISAQMGYHDYPFGS
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 11 Jul 2007 22:03

Assigning to "3.30.450.40" based on similarity with "1jmrA02"

Flow stage update by auto on 11 Jul 2007 22:02

No in_process hits for Domain "1yspA00" ready to be processed

Flow stage update by auto on 11 Jul 2007 22:02

NW result present for Domain "1yspA00"

Flow stage update by auto on 07 Jul 2007 20:00

All required files are present for Domain "1yspA00"

Flow stage update by auto on 06 Jul 2007 14:25

Beginning processing for Domain "1yspA00"

Insertion by auto on 06 Jul 2007 13:59

Final ChopClose added based on similarity with "1ysqA"