Domain assigned by auto on 11 Jul 2007 22:03
Assigning to "3.10.20.90" based on similarity with "1wx7A01"
There are 38 matching structural neighberhood comparisons for CATH ID 3.10.20.90.17.1.1.1.1 (SIMAX score < 5)
>pdb|1yqbA01 LIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVI
Assigning to "3.10.20.90" based on similarity with "1wx7A01"
No in_process hits for Domain "1yqbA01" ready to be processed
NW result present for Domain "1yqbA01"
All required files are present for Domain "1yqbA01"
Beginning processing for Domain "1yqbA01"
nice chopping