Domain assigned by auto on 15 Aug 2007 00:20
Assigning to "3.10.100.10" based on similarity with "1ypqA00"
There are 23 matching structural neighberhood comparisons for CATH ID 3.10.100.10.2.1.1.1.1 (SIMAX score < 5)
>pdb|1ypqB00 RVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPW LWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANL
Assigning to "3.10.100.10" based on similarity with "1ypqA00"
No in_process hits for Domain "1ypqB00" ready to be processed
Domain "1ypqB00" hits Domain "1ypqA00" (100% over 100%) which is currently in process
Domain "1ypqB00" hits Domain "1ypoH00" (97.7272727272727% over 96.2962962962963%) which is currently in process
NW result present for Domain "1ypqB00"
All required files are present for Domain "1ypqB00"
Beginning processing for Domain "1ypqB00"
Final ChopClose added based on similarity with "1ypuA"