Domain assigned by auto on 09 Dec 2006 05:20
Assigning to "3.40.640.10" based on similarity with "1yiyA02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1yizA01 | 12 | 52 |
| 1yizA01 | 310 | 429 |
| 1yizA02 | 53 | 309 |
There are 37 matching structural neighberhood comparisons for CATH ID 3.40.640.10.5.1.1.1.1 (SIMAX score < 5)
>pdb|1yizA02 KYALNALAAAANSPDPLANQYTRGFGHPRLVQALSKLYSQLVDRTINPMTEVLVTVGAYEALYATIQGHVDEGDEVIIIE PFFDCYEPMVKAAGGIPRFIPLKPNKTGGTISSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCK KWNVLCVSDEVYEHMVFEPFEHIRICTLPGMWERTITIGSAGTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQ EAIAVGFETELKRLKS
Assigning to "3.40.640.10" based on similarity with "1yiyA02"
No in_process hits for Domain "1yizA02" ready to be processed
Domain "1yizA02" hits Domain "1yiyB02" (99.6108949416342% over 100%) which is currently in process
Domain "1yizA02" hits Domain "1yiyA02" (99.6108949416342% over 100%) which is currently in process
Domain "1yizA02" hits Domain "1yiyA02" (99.6108949416342% over 100%) which is currently in process
NW result present for Domain "1yizA02"
All required files are present for Domain "1yizA02"
Beginning processing for Domain "1yizA02"
another small batch of choppings