Domain assigned by auto on 28 Apr 2006 20:45
Assigning to "3.30.1330.90" based on similarity with "1ygyA03" (NWSI: 100, NWO: 95.6834532374101, SPS: 93.39, SPO: 94, RMSD: 1.59)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ygyB01 | 3 | 99 |
| 1ygyB01 | 281 | 315 |
| 1ygyB02 | 100 | 280 |
| 1ygyB03 | 316 | 454 |
| 1ygyB04 | 455 | 529 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1ygyB03 GGGVVNEEVAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAVIEDAVTFVNAPALAAERG VTAEICKASESPNHRSVVDVRAVGADGSVVTVSGTLYGPQLSQKIVQINGRHFDLRAQG
Assigning to "3.30.1330.90" based on similarity with "1ygyA03" (NWSI: 100, NWO: 95.6834532374101, SPS: 93.39, SPO: 94, RMSD: 1.59)
NW result present for Domain "1ygyB03"
All required files are present for Domain "1ygyB03"
Beginning processing for Domain "1ygyB03"
Cut based on decision in database "DomChop" on "cathdb"