CATH Domain: 1yg6A00 XML data for domain: 1yg6A00

Molscript image for 1yg6A00
1yg6A00
PDB coordinates for domain 1yg6A00

PDB 1yg6, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.226 2-enoyl-CoA Hydratase; Chain A, domain 1
3.90.226.10 2-enoyl-CoA Hydratase; Chain A, domain 1 Gene3D
3.90.226.10.13
3.90.226.10.13.1
3.90.226.10.13.1.1
3.90.226.10.13.1.1.1
3.90.226.10.13.1.1.1.1

[top]
Segment boundaries for domain 1yg6A00

Chopping figure for domain 1yg6A00
DomainStart PDB ResidueStop PDB Residue
1yg6A00 1 193

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.90.226.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ef8A02 82.50 Propanoate metabolismMethylmalonyl-CoA decarboxylase [EC:4.1.1.41]Methylmalonyl-CoA decarboxylase activityMethylmalonyl-CoA decarboxylaseEscherichia coli K-12 3.90.226.10 179 8 80 3.08 3.82
1uiyA01 80.43 Enoyl-CoA hydrataseThermus thermophilus 3.90.226.10 194 13 77 3.50 4.50
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1yg6A00
ALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTM
QFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQS
LEQIERDTERDRFLSAPEAVEYGLVDSILTHRN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1yg6A00
ALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTM
QFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQS
LEQIERDTERDRFLSAPEAVEYGLVDSILTHRN
BLAST against CATH

[top]
Domain History Events (25)

Domain assigned by auto on 15 Aug 2007 09:06

Assigning to "3.90.226.10" based on similarity with "1tyfA00"

Flow stage update by auto on 15 Aug 2007 09:05

No in_process hits for Domain "1yg6A00" ready to be processed

Update comment by auto on 15 Aug 2007 08:58

Domain "1yg6A00" hits Domain "1yg8L00" (99.4818652849741% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 08:44

Domain "1yg6A00" hits Domain "1yg8U00" (99.4818652849741% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 08:24

Domain "1yg6A00" hits Domain "1yg8O00" (99.4818652849741% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 08:02

Domain "1yg6A00" hits Domain "1yg6K00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 07:34

Domain "1yg6A00" hits Domain "1yg8X00" (99.4818652849741% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 07:10

Domain "1yg6A00" hits Domain "1yg6H00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 06:50

Domain "1yg6A00" hits Domain "1y7oG00" (53.3678756476684% over 96.9543147208122%) which is currently in process

Update comment by auto on 15 Aug 2007 06:28

Domain "1yg6A00" hits Domain "1y7oA00" (53.3678756476684% over 96.9543147208122%) which is currently in process

Update comment by auto on 15 Aug 2007 06:01

Domain "1yg6A00" hits Domain "1y7oD00" (53.3678756476684% over 96.969696969697%) which is currently in process

Update comment by auto on 15 Aug 2007 05:32

Domain "1yg6A00" hits Domain "1y7oF00" (53.3678756476684% over 96.969696969697%) which is currently in process

Update comment by auto on 15 Aug 2007 05:03

Domain "1yg6A00" hits Domain "1y7oE00" (53.3678756476684% over 96.969696969697%) which is currently in process

Update comment by auto on 15 Aug 2007 04:32

Domain "1yg6A00" hits Domain "1y7oC00" (53.3678756476684% over 96.969696969697%) which is currently in process

Update comment by auto on 15 Aug 2007 03:57

Domain "1yg6A00" hits Domain "1tg6D00" (55.9585492227979% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 03:17

Domain "1yg6A00" hits Domain "1tg6E00" (55.9585492227979% over 94.1463414634146%) which is currently in process

Update comment by auto on 15 Aug 2007 02:35

Domain "1yg6A00" hits Domain "1tg6F00" (55.9585492227979% over 98.469387755102%) which is currently in process

Update comment by auto on 15 Aug 2007 01:27

Domain "1yg6A00" hits Domain "1tg6A00" (55.9585492227979% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 23:59

Domain "1yg6A00" hits Domain "1tg6B00" (56.25% over 99.4818652849741%) which is currently in process

Update comment by auto on 14 Aug 2007 22:47

Domain "1yg6A00" hits Domain "1tg6G00" (55.9585492227979% over 95.0738916256158%) which is currently in process

Flow stage update by auto on 07 Aug 2007 14:52

Domain "1yg6A00" hits Domain "1yg6D00" (100% over 100%) which is currently in process

Flow stage update by auto on 07 Aug 2007 14:52

NW result present for Domain "1yg6A00"

Flow stage update by auto on 18 Jul 2007 06:53

All required files are present for Domain "1yg6A00"

Flow stage update by auto on 16 Jul 2007 22:37

Beginning processing for Domain "1yg6A00"

Insertion by auto on 16 Jul 2007 22:10

Final ChopClose added based on similarity with "1tyfA"