CATH Domain: 1yf3A02 XML data for domain: 1yf3A02

Molscript image for 1yf3A02
1yf3A02
PDB coordinates for domain 1yf3A02

PDB 1yf3, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1020 Adenine-specific Methyltransferase; domain 2
1.10.1020.10 Adenine-specific Methyltransferase, Domain 2 Gene3D
1.10.1020.10.2
1.10.1020.10.2.1
1.10.1020.10.2.1.1
1.10.1020.10.2.1.1.1
1.10.1020.10.2.1.1.1.1

Segment boundaries for domain 1yf3A02

Chopping figure for domain 1yf3A02
DomainStart PDB ResidueStop PDB Residue
1yf3A01 1 51
1yf3A01 147 259
1yf3A02 52 146

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|1yf3A02
QEPIIEMYKRLINVSWDDVLKVIKQYKLSKTSKEEFLKLREDYNKTRDPLLLYVLHFHGFSNMIRINYKGNFTTPFGKRT
INKNSEKRFNHFKQN    

Domain COMBS Sequence

>pdb|1yf3A02
QEPIIEMYKRLINVSWDDVLKVIKQYKLSKTSKEEFLKLREDYNKTRDPLLLYVLHFHGFSNMIRINYKGNFTTPFGKRT
INKNSEKRFNHFKQN    

Domain History Events (12)

Domain assigned by auto on 01 Nov 2006 22:04

Assigning to "1.10.1020.10" based on similarity with "1q0sA02"

Flow stage update by auto on 01 Nov 2006 21:56

No in_process hits for Domain "1yf3A02" ready to be processed

Update comment by auto on 01 Nov 2006 18:04

Domain "1yf3A02" hits Domain "1q0tA02" (96.8421052631579% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:27

Domain "1yf3A02" hits Domain "1q0tB02" (96.8421052631579% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "1yf3A02" hits Domain "1q0tB02" (96.8421052631579% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:49

Domain "1yf3A02" hits Domain "1q0tB02" (96.8421052631579% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "1yf3A02" hits Domain "1q0tB02" (96.8421052631579% over 100%) which is currently in process

Flow stage update by auto on 17 Oct 2006 21:24

Domain "1yf3A02" hits Domain "1q0tB02" (96.8421052631579% over 100%) which is currently in process

Flow stage update by auto on 17 Oct 2006 21:24

NW result present for Domain "1yf3A02"

Flow stage update by auto on 13 Oct 2006 12:17

All required files are present for Domain "1yf3A02"

Flow stage update by auto on 12 Oct 2006 21:44

Beginning processing for Domain "1yf3A02"

Insertion by auto on 12 Oct 2006 21:18

Final ChopClose added based on similarity with "1yf3B"