CATH Domain: 1y9zA02 XML data for domain: 1y9zA02

Molscript image for 1y9zA02
1y9zA02
PDB coordinates for domain 1y9zA02

PDB 1y9z, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.50 3-Layer(bba) Sandwich
3.50.30 Glucose Oxidase; domain 1
3.50.30.30 Gene3D
3.50.30.30.1
3.50.30.30.1.1
3.50.30.30.1.1.1
3.50.30.30.1.1.1.1
3.50.30.30.1.1.1.1.1

Segment boundaries for domain 1y9zA02

Chopping figure for domain 1y9zA02
DomainStart PDB ResidueStop PDB Residue
1y9zA01 1 214
1y9zA01 360 435
1y9zA02 215 359

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.50.30.30.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3kasA02 80.17 Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis 3.50.30.30 178 10 69 2.92 4.19
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|1y9zA02
RLADITIGGQSYFSNGVVPHNRLTPSGTSYAPAPINASATGALAECTVNGTSFSCGNMANKICLVERVGNQGSSYPEINS
TKACKTAGAKGIIVYSNSALPGLQNPFLVDANSDITVPSVSVDRATGLALKAKLGQSTTVSNQGN    

Domain COMBS Sequence

>pdb|1y9zA02
RLADITIGGQSYFSNGVVPHNRLTPSGTSYAPAPINASATGALAECTVNGTSFSCGNMANKICLVERVGNQGSSYPEINS
TKACKTAGAKGIIVYSNSALPGLQNPFLVDANSDITVPSVSVDRATGLALKAKLGQSTTVSNQGN    

Domain History Events (11)

Domain assigned by auto on 01 Nov 2006 18:14

Assigning to "3.50.30.30" based on similarity with "1v6cA02"

Flow stage update by auto on 01 Nov 2006 18:04

No in_process hits for Domain "1y9zA02" ready to be processed

Update comment by auto on 01 Nov 2006 14:27

Domain "1y9zA02" hits Domain "1wvmB02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "1y9zA02" hits Domain "1wvmB02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:49

Domain "1y9zA02" hits Domain "1wvmB02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "1y9zA02" hits Domain "1wvmB02" (100% over 100%) which is currently in process

Flow stage update by auto on 17 Oct 2006 17:34

Domain "1y9zA02" hits Domain "1wvmB02" (100% over 100%) which is currently in process

Flow stage update by auto on 17 Oct 2006 17:34

NW result present for Domain "1y9zA02"

Flow stage update by auto on 13 Oct 2006 12:17

All required files are present for Domain "1y9zA02"

Flow stage update by auto on 12 Oct 2006 21:44

Beginning processing for Domain "1y9zA02"

Insertion by auto on 12 Oct 2006 21:17

Final ChopClose added based on similarity with "1v6cA"