CATH Domain: 1y93A00 XML data for domain: 1y93A00

Molscript image for 1y93A00
1y93A00
PDB coordinates for domain 1y93A00

PDB 1y93, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.390 Collagenase (Catalytic Domain)
3.40.390.10 Collagenase (Catalytic Domain) Gene3D
3.40.390.10.4
3.40.390.10.4.1
3.40.390.10.4.1.1
3.40.390.10.4.1.1.1
3.40.390.10.4.1.1.1.1

[top]
Segment boundaries for domain 1y93A00

Chopping figure for domain 1y93A00
DomainStart PDB ResidueStop PDB Residue
1y93A00 106 263

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.40.390.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1slmA00 89.05 Stromelysin-1Metalloendopeptidase activityHomo sapiensMatrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]Intracellular membrane-bounded organelle 3.40.390.10 226 59 69 0.83 1.19
1c7kA00 81.10 Extracellular small neutral proteaseStreptomyces caespitosus 3.40.390.10 132 17 79 3.33 4.18
1k7iA02 80.33 Erwinia chrysanthemiSecreted protease C 3.40.390.10 227 23 62 2.75 4.37
1iabA00 76.97 AstacinAstacus astacus 3.40.390.10 200 12 63 2.88 4.54
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1y93A00
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAF
GPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1y93A00
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHA
FGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 20:34

Assigning to "3.40.390.10" based on similarity with "1rmzA00" (NWSI: 100, NWO: 100, SPS: 97.79, SPO: 99, RMSD: 0.44)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1y93A00"

Flow stage update by auto on 28 Apr 2006 17:47

All required files are present for Domain "1y93A00"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "1y93A00"

Insertion by auto on 09 Mar 2006 22:43

Final ChopClose added based on similarity with "1rmzA" [LEE: 0, LME: 0, MR: 1, LG: 1, SS: 97.79, SI: 100, SO: 100]