Domain assigned by auto on 28 Apr 2006 20:33
Assigning to "2.40.10.10" based on similarity with "1y8tA02" (NWSI: 99.1935483870968, NWO: 99.2, SPS: 97.24, SPO: 98, RMSD: 0.27)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1y8tB01 | 6 | 102 |
| 1y8tB02 | 103 | 226 |
| 1y8tB03 | 227 | 314 |
There are 12 matching structural neighberhood comparisons for CATH ID 2.40.10.10.55.1.1.1.1 (SIMAX score < 5)
>pdb|1y8tB02 ISLGSSSDLRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSTNTVLDAIQTDAAINPGNSGGALVNNAQLVGVNSAIATL GAQSGSIGLGFAIPVDQAKRIADELISTGKA
Assigning to "2.40.10.10" based on similarity with "1y8tA02" (NWSI: 99.1935483870968, NWO: 99.2, SPS: 97.24, SPO: 98, RMSD: 0.27)
NW result present for Domain "1y8tB02"
All required files are present for Domain "1y8tB02"
Beginning processing for Domain "1y8tB02"
Cut based on decision in database "DomChop" on "cathdb"