CATH Domain: 1y7jA00 XML data for domain: 1y7jA00

Molscript image for 1y7jA00
1y7jA00
PDB coordinates for domain 1y7jA00

PDB 1y7j, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.760 Agouti Related Protein; Chain A
4.10.760.10 Agouti Related Protein; Chain A Gene3D
4.10.760.10.1
4.10.760.10.1.1
4.10.760.10.1.1.1
4.10.760.10.1.1.1.1
4.10.760.10.1.1.1.1.1

[top]
Segment boundaries for domain 1y7jA00

Chopping figure for domain 1y7jA00
DomainStart PDB ResidueStop PDB Residue
1y7jA00 93 132

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 4.10.760.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1hykA00 79.59 Adipocytokine signaling pathwayAgouti-related proteinHomo sapiensAgouti related proteinNeuropeptide signaling pathway 4.10.760.10 46 55 86 3.85 4.43
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1y7jA00
CVATRNSCKPPAPACCDPCASCYCRFFRSACYCRVLSLNC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1y7jA00
KKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCYCRFFRSACYCRVLSLNC
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 06 Mar 2006 00:25

Cut based on decision in database "DomChop" on "cathdb"