CATH Domain: 1y62A00 XML data for domain: 1y62A00

Molscript image for 1y62A00
1y62A00
PDB coordinates for domain 1y62A00

PDB 1y62, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.410 Factor Xa Inhibitor
4.10.410.10 Factor Xa Inhibitor Gene3D
4.10.410.10.6
4.10.410.10.6.1
4.10.410.10.6.1.1
4.10.410.10.6.1.1.1
4.10.410.10.6.1.1.1.1

[top]
Segment boundaries for domain 1y62A00

Chopping figure for domain 1y62A00
DomainStart PDB ResidueStop PDB Residue
1y62A00 3 58

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 4.10.410.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1bunB00 89.50 Bungarus multicinctusBeta-bungarotoxin B2 chain 4.10.410.10 61 33 91 1.48 1.61
1tocR02 88.18 OrnithodorinOrnithodoros moubata 4.10.410.10 58 23 89 2.15 2.40
1tocR01 83.38 OrnithodorinOrnithodoros moubata 4.10.410.10 52 11 85 2.72 3.17
1bikA00 80.71 Protein homodimerization activityPlasma membraneNegative regulation of JNK cascadeSerine-type endopeptidase inhibitor activityIgA binding 4.10.410.10 110 25 50 1.35 2.65
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1y62A00
RPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1y62A00
KDRPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCLYT
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 30 Nov 2006 13:30

Assigning to "4.10.410.10" based on similarity with "1y62B00"

Flow stage update by auto on 30 Nov 2006 13:29

No in_process hits for Domain "1y62A00" ready to be processed

Update comment by auto on 30 Nov 2006 09:22

Domain "1y62A00" hits Domain "1y62C00" (100% over 100%) which is currently in process

Update comment by auto on 30 Nov 2006 05:29

Domain "1y62A00" hits Domain "1y62E00" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Nov 2006 05:26

Domain "1y62A00" hits Domain "1y62E00" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Nov 2006 05:26

NW result present for Domain "1y62A00"

Flow stage update by auto on 29 Nov 2006 13:24

All required files are present for Domain "1y62A00"

Flow stage update by auto on 28 Nov 2006 21:32

Beginning processing for Domain "1y62A00"

Insertion by auto on 28 Nov 2006 21:21

Final ChopClose added based on similarity with "1y62B"