CATH Domain: 1y2mD01 XML data for domain: 1y2mD01

Molscript image for 1y2mD01
1y2mD01
PDB coordinates for domain 1y2mD01

PDB 1y2m, Chain D, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.275 Fumarase C; Chain B, domain 1
1.10.275.10 Fumarase/aspartase (N-terminal domain) Gene3D
1.10.275.10.5
1.10.275.10.5.1
1.10.275.10.5.1.1
1.10.275.10.5.1.1.1
1.10.275.10.5.1.1.1.1

[top]
Segment boundaries for domain 1y2mD01

Chopping figure for domain 1y2mD01
DomainStart PDB ResidueStop PDB Residue
1y2mD01 26 271
1y2mD02 272 545
1y2mD02 649 716
1y2mD03 546 648

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1y2mD01
ASTNLAVTTQVTQVDIVEKLAAPTDSTLELDGYSLNLGDVVSAARKGRPVRVKDSDEIRSKIDKSVEFLRSTEDAISLQK
ALLEHQLCGVLPSSFDSFRLGRGLENSLPLEVVRGATIRVNSLTRGHSAVRLVVLEALTNFLNHGITPIVPLRGTISASG
DLSPLSYIAAAISGHPDSKVHVVHEGKEKILYAREAALFNLEPVVLGPKEGLGLVNG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1y2mD01
ASTNLAVAGSHLPTTQVTQVDIVEKXLAAPTDSTLELDGYSLNLGDVVSAARKGRPVRVKDSDEIRSKIDKSVEFLRSQL
SXSVYGVTTGFGGSADTRTEDAISLQKALLEHQLCGVLPSSFDSFRLGRGLENSLPLEVVRGAXTIRVNSLTRGHSAVRL
VVLEALTNFLNHGITPIVPLRGTISASGDLSPLSYIAAAISGHPDSKVHVVHEGKEKILYAREAXALFNLEPVVLGPKEG
LGLVNG
BLAST against CATH

[top]
Domain History Events (16)

Domain assigned by auto on 15 Aug 2007 06:11

Assigning to "1.10.275.10" based on similarity with "1y2mA01"

Flow stage update by auto on 15 Aug 2007 06:01

No in_process hits for Domain "1y2mD01" ready to be processed

Update comment by auto on 15 Aug 2007 05:32

Domain "1y2mD01" hits Domain "1y2mB01" (98.3739837398374% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 05:03

Domain "1y2mD01" hits Domain "1y2mC01" (98.3739837398374% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 04:31

Domain "1y2mD01" hits Domain "1t6pC01" (97.9423868312757% over 98.780487804878%) which is currently in process

Update comment by auto on 15 Aug 2007 03:57

Domain "1y2mD01" hits Domain "1t6pE01" (97.9423868312757% over 98.780487804878%) which is currently in process

Update comment by auto on 15 Aug 2007 03:16

Domain "1y2mD01" hits Domain "1t6pD01" (97.9423868312757% over 98.780487804878%) which is currently in process

Update comment by auto on 15 Aug 2007 02:34

Domain "1y2mD01" hits Domain "1t6pA01" (97.9338842975207% over 98.3739837398374%) which is currently in process

Update comment by auto on 15 Aug 2007 01:26

Domain "1y2mD01" hits Domain "1t6pB01" (97.9423868312757% over 98.780487804878%) which is currently in process

Update comment by auto on 14 Aug 2007 23:58

Domain "1y2mD01" hits Domain "1t6pG01" (97.9423868312757% over 98.780487804878%) which is currently in process

Update comment by auto on 14 Aug 2007 22:46

Domain "1y2mD01" hits Domain "1t6jA01" (97.8354978354978% over 93.9024390243902%) which is currently in process

Flow stage update by auto on 14 Aug 2007 14:08

Domain "1y2mD01" hits Domain "1y2mA01" (98.3739837398374% over 100%) which is currently in process

Flow stage update by auto on 14 Aug 2007 14:08

NW result present for Domain "1y2mD01"

Flow stage update by auto on 08 Aug 2007 10:46

All required files are present for Domain "1y2mD01"

Flow stage update by auto on 05 Aug 2007 18:40

Beginning processing for Domain "1y2mD01"

Insertion by auto on 05 Aug 2007 14:11

Final ChopClose added based on similarity with "1y2mA"