Domain assigned by auto on 15 Aug 2007 05:10
Assigning to "1.20.200.10" based on similarity with "1t6jA02"
CATH Domain: 1y2mC02
1y2mC02
PDB 1y2m, Chain C, Domain 2
Segment boundaries for domain 1y2mC02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1y2mC01 | 26 | 271 |
| 1y2mC02 | 272 | 545 |
| 1y2mC02 | 649 | 716 |
| 1y2mC03 | 546 | 648 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|1y2mC02 TAVSASATLALHDAHLSLLSQSLTATVEAVGHAGSFHPFLHDVTRPHPTQIEVAGNIRKLLEGSRFAVHHEEDEGILRQD RYPLRTSPQWLGPLVSDLIHAHAVLTIEAGQSTTDNPLIDVENKTSHHGGNFQAAAVANTEKTRLGLAQIGKLNFTQLTE LNAGNRGLPSCLAAEDPSLSYHCKGLDIAAAAYTSELGHLANPVTTHVQPAEANQAVNSLALISARRTTESNDVLSLLLA THLYCVLQAIDLRAIEFEFKSTSSPALSYLSPRTQILYAFVREELGVKARRGDVFLGKQEVTIGSNVSKIYEAIKSGRIN NVLLKLA
Domain COMBS Sequence
>pdb|1y2mC02 TAVSASXATLALHDAHXLSLLSQSLTAXTVEAXVGHAGSFHPFLHDVTRPHPTQIEVAGNIRKLLEGSRFAVHHEEEVKV KDDEGILRQDRYPLRTSPQWLGPLVSDLIHAHAVLTIEAGQSTTDNPLIDVENKTSHHGGNFQAAAVANTXEKTRLGLAQ IGKLNFTQLTEXLNAGXNRGLPSCLAAEDPSLSYHCKGLDIAAAAYTSELGHLANPVTTHVQPAEXANQAVNSLALISAR RTTESNDVLSLLLATHLYCVLQAIDLRAIEFEFKSTSSPALSYLSPRTQILYAFVREELGVKARRGDVFLGKQEVTIGSN VSKIYEAIKSGRINNVLLKXLA
Domain History Events (14)
Flow stage update by auto on 15 Aug 2007 05:03
No in_process hits for Domain "1y2mC02" ready to be processed
Update comment by auto on 15 Aug 2007 04:31
Domain "1y2mC02" hits Domain "1t6pD02" (97.3684210526316% over 100%) which is currently in process
Update comment by auto on 15 Aug 2007 03:57
Domain "1y2mC02" hits Domain "1t6pB02" (97.3684210526316% over 100%) which is currently in process
Update comment by auto on 15 Aug 2007 03:16
Domain "1y2mC02" hits Domain "1t6pG02" (97.3684210526316% over 100%) which is currently in process
Update comment by auto on 15 Aug 2007 02:34
Domain "1y2mC02" hits Domain "1t6pC02" (97.3684210526316% over 100%) which is currently in process
Update comment by auto on 15 Aug 2007 01:26
Domain "1y2mC02" hits Domain "1t6pA02" (97.3684210526316% over 100%) which is currently in process
Update comment by auto on 14 Aug 2007 23:58
Domain "1y2mC02" hits Domain "1t6pE02" (97.3684210526316% over 100%) which is currently in process
Update comment by auto on 14 Aug 2007 22:46
Domain "1y2mC02" hits Domain "1t6jA02" (97.3684210526316% over 100%) which is currently in process
Flow stage update by auto on 14 Aug 2007 14:08
Domain "1y2mC02" hits Domain "1y2mA02" (97.3684210526316% over 100%) which is currently in process
Flow stage update by auto on 14 Aug 2007 14:08
NW result present for Domain "1y2mC02"
Flow stage update by auto on 08 Aug 2007 10:46
All required files are present for Domain "1y2mC02"
Flow stage update by auto on 06 Aug 2007 01:49
Beginning processing for Domain "1y2mC02"
Insertion by auto on 05 Aug 2007 22:07
Final ChopClose added based on similarity with "1y2mA"
