Domain assigned by auto on 11 Jul 2007 16:07
Assigning to "3.30.428.10" based on similarity with "1xquA00"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1y23D01 | 5 | 116 |
| 1y23D02 | 117 | 143 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1y23D01 ENCIFCKIIAGDIPSAKVYEDEHVLAFLDISQVTKGHTLVIPKTHIENVYEFTDELAKQYFHAVPKIARAIRDEFEPIGL NTLNNNGEKAGQSVFHYHMHIIPRYGKGDGFG
Assigning to "3.30.428.10" based on similarity with "1xquA00"
No in_process hits for Domain "1y23D01" ready to be processed
NW result present for Domain "1y23D01"
All required files are present for Domain "1y23D01"
Beginning processing for Domain "1y23D01"
nice chopping