CATH Domain: 1y0yA01

There are 17 matching structural neighberhood comparisons for CATH ID 3.40.630.10.9.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1vheA01	91.45	Bacillus subtilisPutative aminopeptidase ysdC	3.40.630.10	268	37	92	1.44	1.56
	1yloA01	90.43	Shigella flexneriPutative uncharacterized protein	3.40.630.10	254	30	95	1.53	1.61
	2cf4A01	87.87	Pyrococcus horikoshiiPutative uncharacterized protein PH0519	3.40.630.10	236	36	92	1.69	1.83
	3cpxB01	87.74	Aminopeptidase, M42 familyCytophaga hutchinsonii ATCC 33406	3.40.630.10	243	24	88	2.24	2.52
	1vhoA01	87.37	Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase	3.40.630.10	237	31	90	2.38	2.63
	2greA01	86.00	Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579	3.40.630.10	233	21	88	2.00	2.27
	1cg2A01	82.68	Pseudomonas sp. RS-16Carboxypeptidase G2	3.40.630.10	279	20	83	2.51	3.01
	2qyvA01	82.42	Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C	3.40.630.10	250	15	90	2.92	3.24
	3ct9B01	81.81	Bacteroides thetaiotaomicronAcetylornithine deacetylase	3.40.630.10	233	14	83	2.65	3.17
	2glfA01	81.64	Thermotoga maritimaProbable M18 family aminopeptidase 1	3.40.630.10	304	16	76	2.48	3.22
	1vgyA01	81.46	Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase	3.40.630.10	256	13	89	2.72	3.05
	1xmbA01	81.27	Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2	3.40.630.10	274	14	83	2.75	3.30
	1z2lB01	80.82	Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding	3.40.630.10	295	16	77	2.89	3.72
	2ijzA01	80.45	Aminopeptidase [EC:3.4.11.-]Pseudomonas aeruginosaProbable M18 family aminopeptidase 2	3.40.630.10	272	8	87	2.83	3.25
	2rb7A01	79.73	Peptidase, M20/M25/M40 familyDesulfovibrio desulfuricans subsp. desulfuricans str. G20	3.40.630.10	231	15	83	3.23	3.89
	2v8hA01	78.68	Beta-alanine synthaseLachancea kluyveri	3.40.630.10	315	17	73	3.33	4.54
	3kasA01	78.54	Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis	3.40.630.10	308	12	72	3.26	4.52

>pdb|1y0yA01
MVDYELLKKVVEAPGVSGYEFLGIRDVVIEEIKDYVDEVKVDKLGNVIAHKKGEGPKVMIAAHMDQGRLERLGKHRFVSI
AFDDRIAVYTILEVAKQLKDAKADVYFVATVQEEVGLRGARTSAFGIEPDYGFAIDVTIAADIPGTPEHKQVTHLGKGTA
IKIMDRSVICHPTIVRWLEELAKKHEIPYQLEILLGGGTDAGAIHLTKAGVPTGALSVPARYIHSNTEVVDERDVDATVE
LMTKALENIHELKI    

>pdb|1y0yA01
MEVRNMVDYELLKKVVEAPGVSGYEFLGIRDVVIEEIKDYVDEVKVDKLGNVIAHKKGEGPKVMIAAHMDQGRLERLGKH
RFVSIAFDDRIAVYTILEVAKQLKDAKADVYFVATVQEEVGLRGARTSAFGIEPDYGFAIDVTIAADIPGTPEHKQVTHL
GKGTAIKIMDRSVICHPTIVRWLEELAKKHEIPYQLEILLGGGTDAGAIHLTKAGVPTGALSVPARYIHSNTEVVDERDV
DATVELMTKALENIHELKI