CATH Domain: 1y0pA03 XML data for domain: 1y0pA03

Molscript image for 1y0pA03
1y0pA03
PDB coordinates for domain 1y0pA03

PDB 1y0p, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.700 Flavocytochrome C3; Chain A, domain 1
3.90.700.10 Flavocytochrome C3; Chain A, domain 1 Gene3D
3.90.700.10.2
3.90.700.10.2.1
3.90.700.10.2.1.1
3.90.700.10.2.1.1.1
3.90.700.10.2.1.1.1.1

[top]
Segment boundaries for domain 1y0pA03

Chopping figure for domain 1y0pA03
DomainStart PDB ResidueStop PDB Residue
1y0pA01 1 99
1y0pA02 103 359
1y0pA02 506 568
1y0pA03 365 502

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.90.700.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1chuA02 79.43 Nicotinate and nicotinamide metabolismMetabolic pathwaysAlanine, aspartate and glutamate metabolismL-aspartate oxidase [EC:1.4.3.16]L-aspartate oxidase activity 3.90.700.10 104 22 63 2.37 3.76
2bs2A02 78.79 Benzoate degradation via CoA ligationButanoate metabolismFumarate reductase flavoprotein subunit [EC:1.3.99.1]Two-component systemOxidative phosphorylation 3.90.700.10 107 18 62 2.26 3.63
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1y0pA03
HPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTA
DSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1y0pA03
HPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTA
DSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPG
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 20:23

Assigning to "3.90.700.10" based on similarity with "1m64A01" (NWSI: 100, NWO: 100, SPS: 98.75, SPO: 100, RMSD: 0.50)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1y0pA03"

Flow stage update by auto on 28 Apr 2006 17:46

All required files are present for Domain "1y0pA03"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "1y0pA03"

Insertion by auto on 09 Mar 2006 20:55

Final ChopClose added based on similarity with "1qjdA" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 97.92, SI: 100, SO: 100]