CATH Domain: 1xxaC00 XML data for domain: 1xxaC00

Molscript image for 1xxaC00
1xxaC00
PDB coordinates for domain 1xxaC00

PDB 1xxa, Chain C, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1360 Gyrase A; domain 2
3.30.1360.40 Gene3D
3.30.1360.40.3
3.30.1360.40.3.1
3.30.1360.40.3.1.1
3.30.1360.40.3.1.1.1
3.30.1360.40.3.1.1.1.1

[top]
Segment boundaries for domain 1xxaC00

Chopping figure for domain 1xxaC00
DomainStart PDB ResidueStop PDB Residue
1xxaC00 81 153

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 3.30.1360.40.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1b4bA00 91.16 Geobacillus stearothermophilusArginine repressor 3.30.1360.40 71 30 97 2.24 2.30
2phcB01 83.99 Pyrococcus horikoshiiPutative uncharacterized protein PH0987 3.30.1360.40 83 5 78 2.04 2.60
3bp8C00 82.68 Amino sugar and nucleotide sugar metabolismPhosphotransferase system (PTS)Glycolysis / GluconeogenesisPTS system glucose-specific EIICB componentPTS system, glucose-specific IIB component [EC:2.7.1.69] 3.30.1360.60 75 9 88 3.33 3.78
3bp3A00 81.17 Amino sugar and nucleotide sugar metabolismPhosphotransferase system (PTS)Glycolysis / GluconeogenesisPTS system glucose-specific EIICB componentPTS system, glucose-specific IIB component [EC:2.7.1.69] 3.30.1360.60 79 9 82 3.40 4.13
2qifA00 80.24 Bacillus subtilisCopper chaperone copZ 3.30.70.100 69 4 75 3.09 4.10
2kt2A00 79.94 Mercuric reductasePseudomonas aeruginosaMercuric reductase [EC:1.16.1.1] 3.30.70.100 69 11 76 3.77 4.91
3cjkB00 79.91 Cu2+-exporting ATPase [EC:3.6.3.4]Copper-dependent protein bindingCopper-transporting ATPase 1Cellular copper ion homeostasisTrans-Golgi network 3.30.70.100 75 8 73 3.07 4.19
2g9oA00 79.05 Cu2+-exporting ATPase [EC:3.6.3.4]Copper-dependent protein bindingCopper-transporting ATPase 1Trans-Golgi networkCellular copper ion homeostasis 3.30.70.100 77 8 72 3.60 4.95
1harA02 78.49 Human immunodeficiency virus type 1 BH10Gag-Pol polyprotein 3.30.70.270 69 8 78 3.12 4.00
1cc8A00 78.18 Copper chaperone activityMetal homeostasis factor ATX1Protein bindingCytosolCopper ion transport 3.30.70.100 72 8 72 3.38 4.66
1i1gA02 77.95 Pyrococcus furiosusHTH-type transcriptional regulator lrpALrp/AsnC family transcriptional regulator, regulator for asnA, asnC and gidA 3.30.70.920 77 12 74 3.38 4.57
1eayD00 77.21 Bacterial chemotaxisTwo-component systemTwo-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]Escherichia coli K-12Chemotaxis protein cheA 3.30.70.400 69 7 80 3.50 4.33
1lfwA03 76.54 Lactobacillus delbrueckii subsp. lactisBeta-Ala-Xaa dipeptidase 3.30.70.360 88 5 76 3.65 4.79
2xmjA00 75.62 Ssr2857 proteinCopper ion bindingProtein bindingSynechocystis sp. PCC 6803 3.30.70.100 63 4 72 3.26 4.49
1u02A02 75.24 Trehalose-6-phosphate phosphatase related proteinThermoplasma acidophilum 3.30.70.1020 73 12 73 3.63 4.91
1tuaA01 74.97 Aeropyrum pernixPutative uncharacterized protein 3.30.1370.10 84 6 72 3.26 4.49
1uv7A00 74.03 Vibrio choleraeGeneral secretion pathway protein M 3.30.1360.100 74 4 72 3.44 4.71
[1]
Displaying entries 1 to 17 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1xxaC00
PLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKDLYEAILELFD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1xxaC00
MSPLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKDLYEAILELFDQEL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:33

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"