CATH Domain: 1xx7A00 XML data for domain: 1xx7A00

Molscript image for 1xx7A00
1xx7A00
PDB coordinates for domain 1xx7A00

PDB 1xx7, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.3210 Hypothetical protein af1432
1.10.3210.10 Hypothetical protein af1432 Gene3D
1.10.3210.10.7
1.10.3210.10.7.1
1.10.3210.10.7.1.1
1.10.3210.10.7.1.1.1
1.10.3210.10.7.1.1.1.1

[top]
Segment boundaries for domain 1xx7A00

Chopping figure for domain 1xx7A00
DomainStart PDB ResidueStop PDB Residue
1xx7A00 1 172

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1xx7A00
SIDLILLAGKLKRIPRMGWLIKGVPNPESVADHSYRVAFITLLLAEELKKKGVEIDVEKALKIAIIHDLGEAIITDLPLS
AQKYLNKEEAEAKALKDVLPEYTELFEEYSKALTLEGQLVKIADKLDMIIQAYEYELSGAKNLSEFWNALEDLEKLEISR
YLREIIEEVRRL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1xx7A00
AHHHHHHGSIDLILLAGKLKRIPRMGWLIKGVPNPESVADHSYRVAFITLLLAEELKKKGVEIDVEKALKIAIIHDLGEA
IITDLPLSAQKYLNKEEAEAKALKDVLPEYTELFEEYSKALTLEGQLVKIADKLDMIIQAYEYELSGAKNLSEFWNALED
LEKLEISRYLREIIEEVRRLKDDH
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 26 Apr 2006 12:36

COMMENT: Sarah: Good scores and nice superposition but there's no strong evidence of homology at the superfamily level. FINAL: Lesley - Excellent scores. Difference in RMSD due to change in random coil to helix. They are related at both the T and H levels. Mark, why didn't we pick up this relationship on the homolcheck pages?

Flow stage update by cuff on 26 Apr 2006 12:36

COMMENT: Sarah: Good scores and nice superposition but there's no strong evidence of homology at the superfamily level. FINAL: Lesley - Excellent scores. Difference in RMSD due to change in random coil to helix. They are related at both the T and H levels. Mark, why didn't we pick up this relationship on the homolcheck pages?

Insertion by sillitoe on 06 Mar 2006 15:53

HomCheck 'New T' domains

Flow stage update by sillitoe on 06 Mar 2006 15:53

HomCheck 'New T' domains

Insertion by auto on 06 Mar 2006 00:23

Cut based on decision in database "DomChop" on "cathdb"