CATH Domain: 1xviA02 XML data for domain: 1xviA02

Molscript image for 1xviA02
1xviA02
PDB coordinates for domain 1xviA02

PDB 1xvi, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.980 Threonyl-tRNA Synthetase; Chain A, domain 2
3.30.980.20 Putative mannosyl-3-phosphoglycerate phosphatase; domain 2 Gene3D
3.30.980.20.1
3.30.980.20.1.1
3.30.980.20.1.1.1
3.30.980.20.1.1.1.1
3.30.980.20.1.1.1.1.1

[top]
Segment boundaries for domain 1xviA02

Chopping figure for domain 1xviA02
DomainStart PDB ResidueStop PDB Residue
1xviA01 4 92
1xviA01 187 235
1xviA02 93 186

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.30.980.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1l6rA02 81.28 Thermoplasma acidophilumPhosphoglycolate phosphatase 3.90.1070.10 63 14 68 2.34 3.43
1wr8A02 78.11 Pyrococcus horikoshiiPhosphoglycolate phosphatase 3.90.1070.10 69 15 72 2.88 3.97
3gygA02 77.49 Bacillus subtilisNTD biosynthesis operon putative hydrolase ntdB 3.30.70.1410 86 5 75 3.35 4.42
2qmwA03 77.09 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysPrephenate dehydratase [EC:4.2.1.51]Similar to chorismate mutaseStaphylococcus aureus subsp. aureus Mu50 3.30.70.260 73 5 64 2.84 4.38
1s2oA02 76.56 Synechocystis sp. PCC 6803Slr0953 protein 3.90.1070.10 71 9 71 3.15 4.41
1y7pB01 74.90 Archaeoglobus fulgidusUncharacterized protein AF_1403 3.30.70.260 80 7 65 2.99 4.53
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1xviA02
SGISHGEISLVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEASVTLIWRDSDERMAQFTARLNELGLQF
MQGARFWHVLDASA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1xviA02
SGISHGEISLVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEASVTLIWRDSDERMAQFTARLNELGLQF
MQGARFWHVLDASA
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:33

HomCheck 'Assigned T' domains

Flow stage update by sillitoe on 06 Mar 2006 15:33

HomCheck 'Assigned T' domains

Insertion by auto on 06 Mar 2006 00:23

Cut based on decision in database "DomChop" on "cathdb"