CATH Domain: 1xttB00 XML data for domain: 1xttB00

Molscript image for 1xttB00
1xttB00
PDB coordinates for domain 1xttB00

PDB 1xtt, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.2020 Gene3D
3.40.50.2020.9
3.40.50.2020.9.1
3.40.50.2020.9.1.1
3.40.50.2020.9.1.1.1
3.40.50.2020.9.1.1.1.1

[top]
Segment boundaries for domain 1xttB00

Chopping figure for domain 1xttB00
DomainStart PDB ResidueStop PDB Residue
1xttB00 2 216

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.2020.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2e55A00 89.49 Pyrimidine metabolismUracil phosphoribosyltransferaseUracil phosphoribosyltransferase [EC:2.4.2.9]Metabolic pathwaysAquifex aeolicus 3.40.50.2020 208 32 98 2.31 2.36
1bd3A00 87.85 Pyrimidine metabolismUracil phosphoribosyltransferaseUracil phosphoribosyltransferase [EC:2.4.2.9]Metabolic pathwaysToxoplasma gondii 3.40.50.2020 224 32 91 2.38 2.60
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1xttB00
PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRA
AVPLVEGLLKAFPKARQGVIGASRVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVS
IISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1xttB00
MPLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILR
AAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKAN
PKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG
BLAST against CATH

[top]
Domain History Events (16)

Domain assigned by auto on 15 Aug 2007 06:10

Assigning to "3.40.50.2020" based on similarity with "1xttD00"

Flow stage update by auto on 15 Aug 2007 06:00

No in_process hits for Domain "1xttB00" ready to be processed

Update comment by auto on 15 Aug 2007 05:31

Domain "1xttB00" hits Domain "1xtuD00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 05:03

Domain "1xttB00" hits Domain "1xtuB00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 04:31

Domain "1xttB00" hits Domain "1xtuE00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 03:57

Domain "1xttB00" hits Domain "1xtuC00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 03:16

Domain "1xttB00" hits Domain "1xtuA00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 02:34

Domain "1xttB00" hits Domain "1xttD00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 01:26

Domain "1xttB00" hits Domain "1xtuH00" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 23:58

Domain "1xttB00" hits Domain "1xtuG00" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:46

Domain "1xttB00" hits Domain "1xttA00" (100% over 100%) which is currently in process

Flow stage update by auto on 20 Jul 2007 06:43

Domain "1xttB00" hits Domain "1xtvD00" (100% over 100%) which is currently in process

Flow stage update by auto on 20 Jul 2007 06:43

NW result present for Domain "1xttB00"

Flow stage update by auto on 16 Jul 2007 22:37

All required files are present for Domain "1xttB00"

Flow stage update by auto on 14 Jul 2007 23:03

Beginning processing for Domain "1xttB00"

Insertion by auto on 14 Jul 2007 22:09

Final ChopClose added based on similarity with "1xttA"