CATH Domain: 1xrbA02 XML data for domain: 1xrbA02

Molscript image for 1xrbA02
1xrbA02
PDB coordinates for domain 1xrbA02

PDB 1xrb, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.10 Gene3D
3.30.300.10.6
3.30.300.10.6.1
3.30.300.10.6.1.1
3.30.300.10.6.1.1.1
3.30.300.10.6.1.1.1.1

[top]
Segment boundaries for domain 1xrbA02

Chopping figure for domain 1xrbA02
DomainStart PDB ResidueStop PDB Residue
1xrbA01 108 135
1xrbA01 244 383
1xrbA02 12 101
1xrbA02 233 243
1xrbA03 1 9
1xrbA03 136 232

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.300.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1pu1A00 77.45 Methanothermobacter thermautotrophicus str. Delta HUncharacterized protein MTH_677 3.30.300.100 91 12 69 3.30 4.76
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1xrbA02
EGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGVLVGGEITTSAWVDIEEITRNTVREIGYVHSDGFDANSCAVLS
AIGKQSPDGGPGDCGLTG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1xrbA02
EGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGXVLVGGEITTSAWVDIEEITRNTVREIGYVHSDXGFDANSCAV
LSAIGKQSPDGGPXGDCGLTG
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1xrb002" to "1xrbA02" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:52

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"