CATH Domain: 1xqoA02 XML data for domain: 1xqoA02

Molscript image for 1xqoA02
1xqoA02
PDB coordinates for domain 1xqoA02

PDB 1xqo, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.340 Endonuclease III; domain 1
1.10.340.30 Hypothetical protein; domain 2 Gene3D
1.10.340.30.1
1.10.340.30.1.1
1.10.340.30.1.1.1
1.10.340.30.1.1.1.1
1.10.340.30.1.1.1.1.1

[top]
Segment boundaries for domain 1xqoA02

Chopping figure for domain 1xqoA02
DomainStart PDB ResidueStop PDB Residue
1xqoA01 2 26
1xqoA01 162 254
1xqoA02 27 161

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.340.30.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1xg7A02 90.75 Pyrococcus furiosusN-glycosylase/DNA lyase 1.10.340.30 143 27 93 1.81 1.95
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1xqoA02
RRDPQYRAVCNVVKRHGETVGSRLAMLNALISYRLTGKGEEHWEYFGKYFSQLEVIDLCRDFLKYIETSPFLKIGVEARK
KRALKACDYVPNLEDLGLTLRQLSHIVGARREQKTLVFTIKILNYAYMCSRGVNR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1xqoA02
RRDPQYRAVCNVVKRHGETVGSRLAMLNALISYRLTGKGEEHWEYFGKYFSQLEVIDLCRDFLKYIETSPFLKIGVEARK
KRALKACDYVPNLEDLGLTLRQLSHIVGARREQKTLVFTIKILNYAYMCSRGVNR
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Flow stage update by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 06 Mar 2006 00:22

Cut based on decision in database "DomChop" on "cathdb"