CATH Domain: 1xmeB01 XML data for domain: 1xmeB01

Molscript image for 1xmeB01
1xmeB01
PDB coordinates for domain 1xmeB01

PDB 1xme, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1070 Rhopdopsin 7-helix transmembrane proteins
1.20.1070.10 Rhopdopsin 7-helix transmembrane proteins Gene3D
1.20.1070.10.11
1.20.1070.10.11.1
1.20.1070.10.11.1.1
1.20.1070.10.11.1.1.1
1.20.1070.10.11.1.1.1.1

[top]
Segment boundaries for domain 1xmeB01

Chopping figure for domain 1xmeB01
DomainStart PDB ResidueStop PDB Residue
1xmeB01 3 46
1xmeB02 47 168

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 1.20.1070.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1junA00 85.35 Pathways in cancerChagas diseaseNeurotrophin signaling pathwayB cell receptor signaling pathwayT cell receptor signaling pathway 1.20.5.170 43 13 86 2.66 3.08
1gl2D00 84.84 Syntaxin-8Rattus norvegicusProtein bindingSyntaxin 8SNARE interactions in vesicular transport 1.20.5.110 54 9 81 3.08 3.78
2ifoA00 84.47 Xanthomonas phage XfCapsid protein G8P 1.20.5.230 46 9 80 2.18 2.71
3efgA00 84.14 Xanthomonas campestris pv. campestrisSlyX proteinProtein slyX homolog 1.20.5.300 49 11 83 3.08 3.68
1lwuC03 82.65 Fibrinogen gamma chainPetromyzon marinus 1.20.5.50 62 6 69 3.14 4.53
2c0wA00 80.36 Enterobacteria phage fdCapsid protein G8P 1.20.5.80 50 9 84 3.29 3.92
3fx7A00 74.28 Helicobacter pyloriPutative uncharacterized protein 1.10.287.850 83 9 53 2.54 4.79
1fs0G02 72.50 Oxidative phosphorylationMetabolic pathwaysATP synthesis coupled proton transportATP synthase gamma chainF-type H+-transporting ATPase subunit gamma [EC:3.6.3.14] 1.10.287.80 89 2 39 1.20 3.05
3b5nJ00 72.28 Cellular membrane fusionSNARE complexPhosphatidylinositol-3,5-bisphosphate bindingSyntaxin 1B/2/3Prospore membrane 1.20.5.110 64 4 42 1.37 3.25
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1xmeB01
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1xmeB01
MVDEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIP
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 20:03

Assigning to "1.20.1070.10" based on similarity with "1ehkB01" (NWSI: 100, NWO: 100, SPS: 96.97, SPO: 100, RMSD: 0.40)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1xmeB01"

Flow stage update by auto on 28 Apr 2006 17:46

All required files are present for Domain "1xmeB01"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1xmeB01"

Insertion by auto on 09 Mar 2006 18:15

Final ChopClose added based on similarity with "1ehkB" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 97.05, SI: 100, SO: 100]