CATH Domain: 1xmbA01 XML data for domain: 1xmbA01

Molscript image for 1xmbA01
1xmbA01
PDB coordinates for domain 1xmbA01

PDB 1xmb, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.13
3.40.630.10.13.1
3.40.630.10.13.1.1
3.40.630.10.13.1.1.1
3.40.630.10.13.1.1.1.1

[top]
Segment boundaries for domain 1xmbA01

Chopping figure for domain 1xmbA01
DomainStart PDB ResidueStop PDB Residue
1xmbA01 37 215
1xmbA01 334 428
1xmbA02 216 333

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.40.630.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1cg2A01 81.67 Pseudomonas sp. RS-16Carboxypeptidase G2 3.40.630.10 279 14 92 4.14 4.49
2cf4A01 79.65 Pyrococcus horikoshiiPutative uncharacterized protein PH0519 3.40.630.10 236 18 82 4.13 4.99
1vgyA01 79.65 Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase 3.40.630.10 256 13 88 3.70 4.17
1vhoA01 79.52 Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase 3.40.630.10 237 12 80 2.84 3.54
3kasA01 79.20 Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis 3.40.630.10 308 11 78 3.06 3.91
1z2lB01 79.10 Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding 3.40.630.10 295 14 82 2.65 3.23
2v8hA01 78.26 Beta-alanine synthaseLachancea kluyveri 3.40.630.10 315 9 76 2.71 3.53
2qyvA01 76.66 Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C 3.40.630.10 250 11 85 4.20 4.90
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1xmbA01
KLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEPPFVALRADMDAL
PIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGI
HLSARIPFGKAASRAGSFLPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYA
SSHSPLYRINEDVLPYGAAIHASMAVQYLKEKAS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1xmbA01
SESPWIAEDTSQIQTKLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGT
GEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKM
REEGALKNVEAIFGIHLSARIPFGKAASRAGSFLPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPG
HFSLLGMQDETNGYASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKASKGSVSGFHEEL
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 22 Feb 2008 05:38

Assigning to "3.40.630.10" based on similarity with "2q43A01"

Flow stage update by auto on 22 Feb 2008 05:18

No in_process hits for Domain "1xmbA01" ready to be processed

Flow stage update by auto on 22 Feb 2008 05:17

NW result present for Domain "1xmbA01"

Flow stage update by auto on 20 Feb 2008 11:08

All required files are present for Domain "1xmbA01"

Flow stage update by auto on 19 Feb 2008 17:05

Beginning processing for Domain "1xmbA01"

Insertion by lewis on 19 Feb 2008 14:40

Accepting this chopping because it is just a repeat of the previous chopping which I only removed because the PDB's residues have been renumbered.