CATH Domain: 1xk7A02 XML data for domain: 1xk7A02

Molscript image for 1xk7A02
1xk7A02
PDB coordinates for domain 1xk7A02

PDB 1xk7, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1540 formyl-coa transferase, domain 3
3.30.1540.10 formyl-coa transferase, domain 3 Gene3D
3.30.1540.10.2
3.30.1540.10.2.1
3.30.1540.10.2.1.1
3.30.1540.10.2.1.1.1
3.30.1540.10.2.1.1.1.1

[top]
Segment boundaries for domain 1xk7A02

Chopping figure for domain 1xk7A02
DomainStart PDB ResidueStop PDB Residue
1xk7A01 -1 226
1xk7A01 330 405
1xk7A02 227 329

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1xk7A02
KGKDPYYAGCGLYKCADGYIVELVGITQIEECFKDIGLAHLLGTPEIPEGTQLIHRIECPYGPLVEEKLDAWLATHTIAE
VKERFAELNIACAKVLTVPELE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1xk7A02
KGKDPYYAGCGLYKCADGYIVXELVGITQIEECFKDIGLAHLLGTPEIPEGTQLIHRIECPYGPLVEEKLDAWLATHTIA
EVKERFAELNIACAKVLTVPELE
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 20:01

Assigning to "3.30.1540.10" based on similarity with "1xa3A02" (NWSI: 99.0291262135922, NWO: 100, SPS: 97.84, SPO: 100, RMSD: 0.57)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1xk7A02"

Flow stage update by auto on 28 Apr 2006 17:46

All required files are present for Domain "1xk7A02"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1xk7A02"

Insertion by auto on 09 Mar 2006 17:43

Final ChopClose added based on similarity with "1xk6A" [LEE: 4, LME: 0, MR: 0, LG: 4, SS: 97.85, SI: 95.8333333333333, SO: 100]