Domain assigned by auto on 28 Apr 2006 19:59
Assigning to "3.40.640.10" based on similarity with "1bkgD02" (NWSI: 41.5525114155251, NWO: 90.495867768595, SPS: 90.15, SPO: 90, RMSD: 1.39)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1xi9A01 | 1 | 49 |
| 1xi9A01 | 292 | 395 |
| 1xi9A02 | 50 | 291 |
There are 3 matching structural neighberhood comparisons for CATH ID 3.40.640.10.42.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1d2fA02 | 86.69 | 3.40.640.10 | 243 | 17 | 96 | 2.06 | 2.14 | |
![]() |
3ffhB02 | 83.08 | 3.40.640.10 | 208 | 20 | 85 | 2.56 | 2.99 | |
![]() |
1uu1A02 | 82.68 | 3.40.640.10 | 203 | 21 | 83 | 2.57 | 3.09 |
>pdb|1xi9A02 HMKEAYCKAIKEGHNYYGDSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPP YTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYD LMTYEGEHISPGSLTKDVPVIVMNGLSKVYFATGWRLGYMYFVDPENKLSEVREAIDRLARIRLCPNTPAQFAAIAGLTG PM
Assigning to "3.40.640.10" based on similarity with "1bkgD02" (NWSI: 41.5525114155251, NWO: 90.495867768595, SPS: 90.15, SPO: 90, RMSD: 1.39)
NW result present for Domain "1xi9A02"
All required files are present for Domain "1xi9A02"
Beginning processing for Domain "1xi9A02"
Cut based on decision in database "DomChop" on "cathdb"