Set cath from cathlist by auto on 05 Mar 2006 18:02
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1xgsA01 | 1 | 194 |
| 1xgsA01 | 272 | 295 |
| 1xgsA02 | 195 | 271 |
There are 3 matching structural neighberhood comparisons for CATH ID 1.10.10.10.14.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3fm3A02 | 89.82 | 1.10.10.10 | 80 | 23 | 96 | 2.03 | 2.11 | |
![]() |
3bz6A02 | 80.39 | 1.10.10.10 | 76 | 11 | 70 | 3.50 | 4.99 | |
![]() |
3dfgA03 | 74.02 | 1.10.10.10 | 48 | 12 | 51 | 2.56 | 4.93 |
>pdb|1xgsA02 GQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEI
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"