Domain assigned by auto on 28 Apr 2006 19:58
Assigning to "3.90.25.10" based on similarity with "1k6iA02" (NWSI: 100, NWO: 100, SPS: 99.25, SPO: 100, RMSD: 0.13)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1xgkA01 | 3 | 151 |
| 1xgkA01 | 191 | 219 |
| 1xgkA01 | 275 | 328 |
| 1xgkA02 | 152 | 190 |
| 1xgkA02 | 220 | 274 |
| 1xgkA02 | 329 | 351 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1xgkA02 IYNNNFTSLPYPLFQMELMPDGTFEWHAPFDPDIPLPWLFETLSPVQVCAAFSRALNRRVTYVQVPKVEIKVNIPVGYRE QLEAIEVVFGEHKARDMEEYAREVFPIEEEANGLDWM
Assigning to "3.90.25.10" based on similarity with "1k6iA02" (NWSI: 100, NWO: 100, SPS: 99.25, SPO: 100, RMSD: 0.13)
NW result present for Domain "1xgkA02"
All required files are present for Domain "1xgkA02"
Beginning processing for Domain "1xgkA02"