CATH Domain: 1xg7B01 XML data for domain: 1xg7B01

Molscript image for 1xg7B01
1xg7B01
PDB coordinates for domain 1xg7B01

PDB 1xg7, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1670 Endonuclease Iii, domain 2
1.10.1670.10 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) Gene3D
1.10.1670.10.5
1.10.1670.10.5.1
1.10.1670.10.5.1.1
1.10.1670.10.5.1.1.1
1.10.1670.10.5.1.1.1.1

[top]
Segment boundaries for domain 1xg7B01

Chopping figure for domain 1xg7B01
DomainStart PDB ResidueStop PDB Residue
1xg7B01 3 23
1xg7B01 167 241
1xg7B02 24 166

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.1670.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1xqoA01 85.93 Pyrobaculum aerophilumDNA-(apurinic or apyrimidinic site) lyase [EC:4.2.99.18]N-glycosylase/DNA lyase 1.10.1670.10 117 27 74 2.48 3.34
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1xg7B01
ELVEIIKGIGIEGAKEVEEKVYPMEIPIPEDLRIKSVTSKLTQEKPTKFWMKIGQESGVPPLHIDSLIWPLLGNADLTPL
DIELRNKLMKLTELLG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1xg7B01
AHHHHHHGSRELVEIIKGIGIEGAKEVEEKVYPMEIPIPEDLRIKSVTSKLTQEKPTKFWMKIGQESGVPPLHIDSLIWP
LLGNADLTPLDIELRNKLMKLTELLGL
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:58

Assigning to "1.10.1670.10" based on similarity with "1xg7A01" (NWSI: 100, NWO: 100, SPS: 96.68, SPO: 94, RMSD: 0.47)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1xg7B01"

Flow stage update by auto on 28 Apr 2006 17:46

All required files are present for Domain "1xg7B01"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1xg7B01"

Insertion by auto on 06 Mar 2006 00:19

Cut based on decision in database "DomChop" on "cathdb"