CATH Domain: 1x9xA00 XML data for domain: 1x9xA00

Molscript image for 1x9xA00
1x9xA00
PDB coordinates for domain 1x9xA00

PDB 1x9x, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.50 Transcription Factor, Ets-1 Gene3D
1.10.150.50.12
1.10.150.50.12.1
1.10.150.50.12.1.1
1.10.150.50.12.1.1.1
1.10.150.50.12.1.1.1.1

[top]
Segment boundaries for domain 1x9xA00

Chopping figure for domain 1x9xA00
DomainStart PDB ResidueStop PDB Residue
1x9xA00 7 68

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 1.10.150.50.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1go3F01 80.19 Pyrimidine metabolismPurine metabolismMethanocaldococcus jannaschiiDNA-directed RNA polymerase subunit F [EC:2.7.7.6]Uncharacterized protein MJ0039 1.10.150.80 60 15 85 3.15 3.68
2nyvA02 74.70 Phosphoglycolate phosphatase [EC:3.1.3.18]Metabolic pathwaysGlyoxylate and dicarboxylate metabolismAquifex aeolicusPhosphoglycolate phosphatase 1.10.150.240 64 11 85 3.87 4.50
2hdoA02 73.98 Phosphoglycolate phosphatase [EC:3.1.3.18]Lactobacillus plantarumMetabolic pathwaysGlyoxylate and dicarboxylate metabolismPhosphoglycolate phosphatase (Putative) 1.10.150.240 59 8 82 3.74 4.55
1kl9A02 73.88 Translation initiation factor activityTranslation initiation factor eIF-2 alpha subunitEukaryotic translation initiation factor 2 subunit 1PolysomeHomo sapiens 1.10.150.190 92 12 63 2.83 4.49
2a19A02 73.47 Translation initiation factor activityTranslation initiation factor eIF-2 alpha subunitEukaryotic translation initiation factor 2 complexEukaryotic translation initiation factor 2 subunit alphaSaccharomyces cerevisiae 1.10.150.190 85 8 69 3.27 4.71
1rykA00 69.04 UPF0337 protein yjbJProtein bindingEscherichia coli K-12 1.10.1470.10 69 8 76 3.62 4.71
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1x9xA00
LPFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1x9xA00
DEKTNDLPFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQR
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:49

Assigning to "1.10.150.50" based on similarity with "1x9xB00" (NWSI: 100, NWO: 100, SPS: 97.20, SPO: 100, RMSD: 0.63)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1x9xA00"

Flow stage update by auto on 28 Apr 2006 17:46

All required files are present for Domain "1x9xA00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1x9xA00"

Insertion by auto on 09 Mar 2006 13:59

Final ChopClose added based on similarity with "1ow5A" [LEE: 1, LME: 0, MR: 0, LG: 1, SS: 88.29, SI: 100, SO: 80]