Insertion by sillitoe on 06 Mar 2006 15:40
HomCheck 'Assigned H' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1x9nA01 | 262 | 544 |
| 1x9nA02 | 545 | 570 |
| 1x9nA02 | 697 | 754 |
| 1x9nA03 | 571 | 696 |
| 1x9nA04 | 755 | 901 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1x9nA03 GQRAQIHALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASE IQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFA