CATH Domain: 1x7oA02 XML data for domain: 1x7oA02

Molscript image for 1x7oA02
1x7oA02
PDB coordinates for domain 1x7oA02

PDB 1x7o, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1280 Alpha/beta knot
3.40.1280.10 Gene3D
3.40.1280.10.11
3.40.1280.10.11.1
3.40.1280.10.11.1.1
3.40.1280.10.11.1.1.1
3.40.1280.10.11.1.1.1.1

[top]
Segment boundaries for domain 1x7oA02

Chopping figure for domain 1x7oA02
DomainStart PDB ResidueStop PDB Residue
1x7oA01 18 116
1x7oA02 117 284

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.1280.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gz0B02 88.01 RRNA (guanosine-2'-O-)-methyltransferase activityEnzyme-directed rRNA 2'-O-methylationRNA methyltransferase, TrmH family [EC:2.1.1.-]Escherichia coli K-1223S rRNA (guanosine-2'-O-)-methyltransferase rlmB 3.40.1280.10 161 31 91 1.92 2.10
3dcmX00 81.43 Thermotoga maritimaUncharacterized protein TM_1570 3.40.1280.10 188 15 79 3.56 4.46
1k3rA01 78.54 Hypothetical proteinMethanothermobacter thermautotrophicus str. Delta HConserved protein 3.40.1280.10 191 12 74 3.55 4.74
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1x7oA02
LDRIPVREDFLGVLFDRPTSPGNIGSIIRSADALGAHGLIVAGHAADVYDPKSVRSSTGSLFSLPAVRVPSPGEVDWVEA
RRAAGTPIVLVGTDEHGDCDVFDFDFTQPTLLLIGNETAGLSNAWRTLCDYTVSIPAGSASSLNAANAATAILYEAVRQR
ISGRTA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1x7oA02
LDRIPVREDFLGVLFDRPTSPGNIGSIIRSADALGAHGLIVAGHAADVYDPKSVRSSTGSLFSLPAVRVPSPGEVXDWVE
ARRAAGTPIVLVGTDEHGDCDVFDFDFTQPTLLLIGNETAGLSNAWRTLCDYTVSIPXAGSASSLNAANAATAILYEAVR
QRISGRTATTP
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:47

Assigning to "3.40.1280.10" based on similarity with "1x7oB02" (NWSI: 98.8304093567251, NWO: 100, SPS: 96.15, SPO: 100, RMSD: 0.66)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1x7oA02"

Flow stage update by auto on 28 Apr 2006 17:46

All required files are present for Domain "1x7oA02"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1x7oA02"

Insertion by auto on 06 Mar 2006 00:17

Cut based on decision in database "DomChop" on "cathdb"