CATH Domain: 1x75A00 XML data for domain: 1x75A00

Molscript image for 1x75A00
1x75A00
PDB coordinates for domain 1x75A00

PDB 1x75, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.268 Topoisomerase; domain 3
1.10.268.10 Topoisomerase, domain 3 Gene3D
1.10.268.10.1
1.10.268.10.1.1
1.10.268.10.1.1.1
1.10.268.10.1.1.1.1
1.10.268.10.1.1.1.1.2

[top]
Segment boundaries for domain 1x75A00

Chopping figure for domain 1x75A00
DomainStart PDB ResidueStop PDB Residue
1x75A00 363 494

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 1.10.268.10.1.1.1.1.2 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1bgwA03 82.73 Reciprocal meiotic recombinationRegulation of mitotic recombinationDNA topoisomerase 2DNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 1.10.268.10 110 11 68 1.80 2.64
1bjtA03 82.08 Reciprocal meiotic recombinationRegulation of mitotic recombinationDNA topoisomerase 2DNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 1.10.268.10 106 11 68 1.85 2.71
3l4jA05 79.22 Reciprocal meiotic recombinationDNA topoisomerase 2Regulation of mitotic recombinationDNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 1.10.268.10 153 10 61 2.28 3.71
1skvA00 75.23 Protein D-63Sulfolobus virus 1 1.10.287.660 62 9 41 1.79 4.36
1urfA00 74.72 CytoplasmSerine/threonine-protein kinase N1Plasma membraneHomo sapiensActivation of JUN kinase activity 1.10.287.160 81 6 45 1.98 4.33
1nt2B02 74.57 Archaeoglobus fulgidusProtein bindingPutative uncharacterized protein 1.10.287.660 67 10 44 2.03 4.59
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1x75A00
TRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLNVAAMLEDDAARPEWLEPEFGVRDG
LYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1x75A00
TRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFG
VRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGS
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 26 Apr 2009 20:31

Assigning to "1.10.268.10" based on similarity with "1x75B00"

Flow stage update by auto on 26 Apr 2009 20:21

No in_process hits for Domain "1x75A00" ready to be processed

Update comment by auto on 26 Apr 2009 17:19

Domain "1x75A00" hits Domain "1x75B00" (100% over 100%) which is currently in process

Flow stage update by auto on 26 Apr 2009 17:08

Domain "1x75A00" hits Domain "1x75B00" (100% over 100%) which is currently in process

Flow stage update by auto on 26 Apr 2009 17:08

NW result present for Domain "1x75A00"

Flow stage update by auto on 25 Apr 2009 08:08

All required files are present for Domain "1x75A00"

Flow stage update by auto on 24 Apr 2009 02:31

Beginning processing for Domain "1x75A00"

Insertion by auto on 23 Apr 2009 20:13

Final ChopClose added based on similarity with "1x75B"