CATH Domain: 1x6aA01 XML data for domain: 1x6aA01

Molscript image for 1x6aA01
1x6aA01
PDB coordinates for domain 1x6aA01

PDB 1x6a, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.10 Ribbon
2.10.110 Cysteine Rich Protein
2.10.110.10 Cysteine Rich Protein Gene3D
2.10.110.10.8
2.10.110.10.8.1
2.10.110.10.8.1.1
2.10.110.10.8.1.1.1
2.10.110.10.8.1.1.1.1

[top]
Segment boundaries for domain 1x6aA01

Chopping figure for domain 1x6aA01
DomainStart PDB ResidueStop PDB Residue
1x6aA01 15 76

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 2.10.110.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2vutI00 77.69 Nitrogen regulatory protein areASequence-specific DNA bindingGATA-binding protein, other eukaryoteEmericella nidulansProtein binding 3.30.50.10 42 9 53 1.83 3.44
3g6eU00 73.61 50S ribosomal protein L24eHaloarcula marismortui 2.30.170.20 53 20 54 2.35 4.29
1vq8U00 73.12 50S ribosomal protein L24eHaloarcula marismortui 2.30.170.20 53 20 54 2.37 4.32
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1x6aA01
GEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1x6aA01
GEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVS
BLAST against CATH

[top]
Domain History Events (83)

Domain assigned by cuff on 04 Dec 2008 17:52

same superfamily

Domain assignment manual match h by cuff on 04 Dec 2008 17:51

same spuerfamily

Homcheck allotment by cuff on 04 Dec 2008 17:49

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 04 Dec 2008 17:49

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 15 Oct 2008 04:52

Domain "1x6aA01" SCOP scan with no results - this probably hasn't been classified in SCOP yet

Domain scan scop cath by auto on 15 Oct 2008 04:51

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 1x6aA01

Flow stage update by auto on 15 Oct 2008 04:27

Retrieved PRC_PFAMCATH results for job ID SID2266910379475904 and results inserted.

Domain scan prc pfamcath by auto on 15 Oct 2008 04:26

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 10 results for 1x6aA01

Update comment by auto on 10 Oct 2008 21:09

PRC_PFAMCATH job SID2266910379475904 is not yet finished.

Flow stage update by auto on 10 Oct 2008 21:08

The entry "1x6aA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 10 Oct 2008 21:08

The entry "1x6aA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 10 Oct 2008 20:45

Retrieved SSAP results for job ID SID9255586596735636 and results inserted.

Domain scan ssap cath by auto on 10 Oct 2008 20:44

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 496 results for 1x6aA01

Update comment by auto on 09 Oct 2008 21:28

SSAP job SID9255586596735636 is not yet finished.

Ssap cath submit by auto on 09 Oct 2008 21:24

The entry "1x6aA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Oct 2008 21:24

The entry "1x6aA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Oct 2008 20:42

Retrieved PRC results for job ID SID3845168900037080 and inserted them into the database.

Domain scan prc cath by auto on 09 Oct 2008 20:42

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 1x6aA01

Update comment by auto on 08 Oct 2008 12:31

PRC job SID3845168900037080 is not yet finished.

Prc cath submit by auto on 08 Oct 2008 12:24

The entry "1x6aA01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 12:24

The entry "1x6aA01" has been submitted to the PRC webservice.

Flow stage update by auto on 08 Oct 2008 11:46

Retrieved HMM(SAM) results for job ID SID2421263584372256 and inserted them into the database.

Domain scan sam cath by auto on 08 Oct 2008 11:45

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 10 results for 1x6aA01

Update comment by auto on 03 Oct 2008 11:48

HMM(SAM) job SID2421263584372256 is not yet finished.

Sam cath submit by auto on 03 Oct 2008 11:39

The entry "1x6aA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 11:39

The entry "1x6aA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 08:59

Unable to retrieve "1x6aA01" HMM(SAM) results for job "SID4751093162998544"

Update comment by auto on 03 Oct 2008 00:15

HMM(SAM) job SID4751093162998544 is not yet finished.

Flow stage update by auto on 02 Oct 2008 23:58

The entry "1x6aA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 23:58

The entry "1x6aA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 20:50

Unable to retrieve "1x6aA01" HMM(SAM) results for job "SID5291729220664320"

Update comment by auto on 02 Oct 2008 18:10

HMM(SAM) job SID5291729220664320 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 17:57

The entry "1x6aA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 17:57

The entry "1x6aA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 14:58

Unable to retrieve "1x6aA01" HMM(SAM) results for job "SID4382822161497920"

Update comment by auto on 02 Oct 2008 11:56

HMM(SAM) job SID4382822161497920 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 11:45

The entry "1x6aA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 11:45

The entry "1x6aA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 09:15

Unable to retrieve "1x6aA01" HMM(SAM) results for job "SID3981868251025312"

Update comment by auto on 02 Oct 2008 03:28

HMM(SAM) job SID3981868251025312 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 02:58

The entry "1x6aA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 02:58

The entry "1x6aA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 01 Oct 2008 23:56

Retrieved "1x6aA01" CATHEDRAL results for job ID SID1083938089429036 and inserted them into the database.

Domain scan cathedral cath by auto on 01 Oct 2008 23:55

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 113 results for 1x6aA01

Update comment by auto on 29 Sep 2008 04:05

"1x6aA01" CATHEDRAL job SID1083938089429036 is not yet finished.

Cathedral cath submit by auto on 29 Sep 2008 03:48

The entry "1x6aA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 29 Sep 2008 03:48

The entry "1x6aA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 28 Sep 2008 20:33

Giving up on "1x6aA01" CATHEDRAL job SID3008273150017264 because submission time of Mon Sep 22 18:48:40 2008 is more than 518400 seconds older than current time (Sun Sep 28 20:33:42 2008).

Update comment by auto on 22 Sep 2008 19:04

"1x6aA01" CATHEDRAL job SID3008273150017264 is not yet finished.

Cathedral cath submit by auto on 22 Sep 2008 18:48

The entry "1x6aA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 18:48

The entry "1x6aA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Sep 2008 15:26

Giving up on "1x6aA01" CATHEDRAL job SID8197164720831580 because submission time of Tue Sep 16 14:50:21 2008 is more than 518400 seconds older than current time (Mon Sep 22 15:26:33 2008).

Update comment by auto on 16 Sep 2008 15:05

"1x6aA01" CATHEDRAL job SID8197164720831580 is not yet finished.

Cathedral cath submit by auto on 16 Sep 2008 14:50

The entry "1x6aA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:50

The entry "1x6aA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 16 Sep 2008 14:23

ScanList with 11996 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1x6aA01.scanlist" for "1x6aA01"

Write scan list by auto on 16 Sep 2008 14:23

Writing ScanList containing 11996 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1x6aA01.scanlist" for domain "1x6aA01"

Update comment by auto on 16 Sep 2008 11:22

Waiting for 27 new domains (example : 2qwvB00) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 22:07

Waiting for 40 new domains (example : 2honA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 17:28

Waiting for 77 new domains (example : 2o6iA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 15:20

Waiting for 114 new domains (example : 2r7bA02) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 11:22

Waiting for 163 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 09:59

Waiting for 246 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Sep 2008 03:25

Waiting for 269 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 23:23

Waiting for 305 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 21:06

Waiting for 360 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 17:36

Waiting for 411 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 14:48

Waiting for 507 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 08:50

Waiting for 561 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Sep 2008 04:56

Waiting for 653 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Sep 2008 20:29

Waiting for 715 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Sep 2008 17:48

Waiting for 781 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Sep 2008 14:30

Waiting for 845 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Sep 2008 11:39

Waiting for 905 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Sep 2008 08:52

Waiting for 949 new domains (example : 2c00A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Sep 2008 06:54

Waiting for 1005 new domains (example : 2a91A03) to be processed so that they can be scanned against too.

Update comment by auto on 12 Sep 2008 23:24

Waiting for 1048 new domains (example : 1ycee01) to be processed so that they can be scanned against too.

Flow stage update by auto on 12 Sep 2008 23:24

No satisfactory AssignClose result found.

Flow stage update by auto on 12 Sep 2008 23:08

No in_process hits for Domain "1x6aA01" ready to be processed

Flow stage update by auto on 12 Sep 2008 23:08

NW result present for Domain "1x6aA01"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "1x6aA01"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "1x6aA01"

Insertion by cuff on 10 Sep 2008 12:07

nice chopping