Domain assigned by auto on 06 Dec 2006 21:26
Assigning to "3.40.1480.10" based on similarity with "1o0uA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1x3lA01 | 1 | 21 |
| 1x3lA01 | 267 | 436 |
| 1x3lA02 | 22 | 266 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1x3lA01 MIAMDIREIGLRLVGEAIKAASNSISCEAIAREAQRLGFKAYIMTTTLEGEAKDAGLFIGSIVQEIAERGRPFEPPVVLV FGGETTVTIEGKGGKGGPNQEIALSATRKISDLEALIVAFDTDGTDGPTDAAGGIVDGTTYKKLREKGIDVEKVLKEHNS YEALKKVGGLLFTGPTGTNVNSIVIAIVTSK
Assigning to "3.40.1480.10" based on similarity with "1o0uA01"
No in_process hits for Domain "1x3lA01" ready to be processed
NW result present for Domain "1x3lA01"
All required files are present for Domain "1x3lA01"
Beginning processing for Domain "1x3lA01"
nice batch of choppings