CATH Domain: 1x14A01 XML data for domain: 1x14A01

Molscript image for 1x14A01
1x14A01
PDB coordinates for domain 1x14A01

PDB 1x14, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1770 Gene3D
3.40.50.1770.2
3.40.50.1770.2.1
3.40.50.1770.2.1.1
3.40.50.1770.2.1.1.1
3.40.50.1770.2.1.1.1.1

[top]
Segment boundaries for domain 1x14A01

Chopping figure for domain 1x14A01
DomainStart PDB ResidueStop PDB Residue
1x14A01 1000 1136
1x14A01 1319 1372
1x14A02 1137 1318

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.50.1770.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1pjcA01 88.57 Alanine dehydrogenasePhormidium lapideum 3.40.50.1770 185 26 92 2.37 2.56
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1x14A01
HGRIGIPRERLTNETRVAATPKTVEQLLKLGFTVAVESGAGQLASFDDKAFVQAGAEIVEGNSVWQSEIILKVNAPLDDE
IALLNPGTTLVSFIWPAQNPELMQKLAERNVTVMAMDSVPRISRAQSLDALSSMANILPTQSSQLYGTNLVNLLKLLCKE
KDGNITVDFDDVVIRGVTVIRAGEITWPAPP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1x14A01
MHHHHHHGRIGIPRERLTNETRVAATPKTVEQLLKLGFTVAVESGAGQLASFDDKAFVQAGAEIVEGNSVWQSEIILKVN
APLDDEIALLNPGTTLVSFIWPAQNPELMQKLAERNVTVMAMDSVPRISRAQSLDALSSMANILPTQSSQLYGTNLVNLL
KLLCKEKDGNITVDFDDVVIRGVTVIRAGEITWPAPP
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 26 Apr 2009 14:46

Assigning to "3.40.50.1770" based on similarity with "1x15B01"

Flow stage update by auto on 26 Apr 2009 14:45

No in_process hits for Domain "1x14A01" ready to be processed

Update comment by auto on 26 Apr 2009 14:43

Domain "1x14A01" hits Domain "1x13A01" (100% over 98.0099502487562%) which is currently in process

Update comment by auto on 26 Apr 2009 14:38

Domain "1x14A01" hits Domain "1x13B01" (100% over 97.5247524752475%) which is currently in process

Update comment by auto on 26 Apr 2009 14:35

Domain "1x14A01" hits Domain "1x15B01" (100% over 98.9949748743719%) which is currently in process

Update comment by auto on 26 Apr 2009 14:32

Domain "1x14A01" hits Domain "1x15A01" (100% over 98.0099502487562%) which is currently in process

Update comment by auto on 26 Apr 2009 14:21

Domain "1x14A01" hits Domain "1x14B01" (100% over 98.5%) which is currently in process

Flow stage update by auto on 26 Apr 2009 14:08

Domain "1x14A01" hits Domain "1x14B01" (100% over 98.5%) which is currently in process

Flow stage update by auto on 26 Apr 2009 14:08

NW result present for Domain "1x14A01"

Flow stage update by auto on 25 Apr 2009 08:08

All required files are present for Domain "1x14A01"

Flow stage update by auto on 24 Apr 2009 02:31

Beginning processing for Domain "1x14A01"

Insertion by auto on 23 Apr 2009 21:11

Final ChopClose added based on similarity with "1x15B"