CATH Domain: 1x0lA00 XML data for domain: 1x0lA00

Molscript image for 1x0lA00
1x0lA00
PDB coordinates for domain 1x0lA00

PDB 1x0l, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.718 Isopropylmalate Dehydrogenase
3.40.718.10 Isopropylmalate Dehydrogenase Gene3D
3.40.718.10.1
3.40.718.10.1.2
3.40.718.10.1.2.1
3.40.718.10.1.2.1.1
3.40.718.10.1.2.1.1.1

[top]
Segment boundaries for domain 1x0lA00

Chopping figure for domain 1x0lA00
DomainStart PDB ResidueStop PDB Residue
1x0lA00 2 334

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.40.718.10.1.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1hqsA00 86.28 Bacillus subtilisIsocitrate dehydrogenase [NADP]Citrate cycle (TCA cycle)Isocitrate dehydrogenase [EC:1.1.1.42]Glutathione metabolism 3.40.718.10 422 34 82 2.02 2.46
1cnzA00 86.06 Metabolic pathwaysValine, leucine and isoleucine biosynthesisSalmonella enterica subsp. enterica serovar Typhimurium3-isopropylmalate dehydrogenase3-isopropylmalate dehydrogenase [EC:1.1.1.85] 3.40.718.10 363 31 88 2.75 3.12
1w0dA00 85.88 Metabolic pathwaysValine, leucine and isoleucine biosynthesis3-isopropylmalate dehydrogenase3-isopropylmalate dehydrogenase [EC:1.1.1.85]Mycobacterium tuberculosis 3.40.718.10 337 31 84 2.51 2.96
2uxqB00 81.85 Desulfotalea psychrophilaCitrate cycle (TCA cycle)Isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]Metabolic pathwaysProbable isocitrate dehydrogenase 3.40.718.10 401 17 85 3.30 3.88
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1x0lA00
AYRICLIEGDGIGHEVIPAARRVLEATGLPLEFVEAEAGWETFERRGTSVPEETVEKILSCHATLFGAATSPTRKVPGFF
GAIRYLRRRLDLYANVRPAKSRPVPGSRPGVDLVIVRENTEGLYVEQERRYLDVAIADAVISKKASERIGRAALRIAEGR
PRKTLHIAHKANVLPLTQGLFLDTVKEVAKDFPLVNVQDIIVDNCAMQLVMRPERFDVIVTTNLLGDILSDLAAGLVGGL
GLAPSGNIGDTTAVFEPVHGSAPDIAGKGIANPTAAILSAAMMLDYLGEKEAAKRVEKAVDLVLERGPRTPDLGGDATTE
AFTEAVVEALKSL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1x0lA00
AYRICLIEGDGIGHEVIPAARRVLEATGLPLEFVEAEAGWETFERRGTSVPEETVEKILSCHATLFGAATSPTRKVPGFF
GAIRYLRRRLDLYANVRPAKSRPVPGSRPGVDLVIVRENTEGLYVEQERRYLDVAIADAVISKKASERIGRAALRIAEGR
PRKTLHIAHKANVLPLTQGLFLDTVKEVAKDFPLVNVQDIIVDNCAMQLVMRPERFDVIVTTNLLGDILSDLAAGLVGGL
GLAPSGNIGDTTAVFEPVHGSAPDIAGKGIANPTAAILSAAMMLDYLGEKEAAKRVEKAVDLVLERGPRTPDLGGDATTE
AFTEAVVEALKSL
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 15 Aug 2007 01:50

Assigning to "3.40.718.10" based on similarity with "1x0lB00"

Flow stage update by auto on 15 Aug 2007 01:28

No in_process hits for Domain "1x0lA00" ready to be processed

Update comment by auto on 15 Aug 2007 00:00

Domain "1x0lA00" hits Domain "1x0lB00" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:47

Domain "1x0lA00" hits Domain "1wpwB00" (42.9429429429429% over 95.8333333333333%) which is currently in process

Flow stage update by auto on 19 Jul 2007 22:49

Domain "1x0lA00" hits Domain "1wpwA00" (42.9429429429429% over 95.8333333333333%) which is currently in process

Flow stage update by auto on 19 Jul 2007 22:49

NW result present for Domain "1x0lA00"

Flow stage update by auto on 16 Jul 2007 22:37

All required files are present for Domain "1x0lA00"

Flow stage update by auto on 14 Jul 2007 17:56

Beginning processing for Domain "1x0lA00"

Insertion by auto on 14 Jul 2007 16:16

Final ChopClose added based on similarity with "1x0lB"