Domain assigned by auto on 15 Aug 2007 01:50
Assigning to "2.60.350.10" based on similarity with "1x0cB01"
CATH Domain: 1x0cA01
1x0cA01
PDB 1x0c, Chain A, Domain 1
Segment boundaries for domain 1x0cA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1x0cA01 | 19 | 189 |
| 1x0cA02 | 191 | 564 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|1x0cA01 MAVTANNSQLLTWWHNTGEINTQTPVADGNVRQSGLYSVKVQTTPASSSLYYDSFVYLAIPGNGMSDQLQYTQGYNQTQA WTSFLYSHDATVKISRNGSSANSNVVIRPTSLNFPVRYDNQSVYITVPYSPTGYRFSVEFDDDLISLAPSGARQPENALL IFASPFENSST
Domain History Events (9)
Flow stage update by auto on 15 Aug 2007 01:28
No in_process hits for Domain "1x0cA01" ready to be processed
Update comment by auto on 15 Aug 2007 00:00
Domain "1x0cA01" hits Domain "1x0cB01" (100% over 100%) which is currently in process
Update comment by auto on 14 Aug 2007 22:47
Domain "1x0cA01" hits Domain "1wmrA01" (100% over 100%) which is currently in process
Flow stage update by auto on 19 Jul 2007 22:49
Domain "1x0cA01" hits Domain "1wmrB01" (100% over 100%) which is currently in process
Flow stage update by auto on 19 Jul 2007 22:49
NW result present for Domain "1x0cA01"
Flow stage update by auto on 16 Jul 2007 22:37
All required files are present for Domain "1x0cA01"
Flow stage update by auto on 14 Jul 2007 17:56
Beginning processing for Domain "1x0cA01"
Insertion by auto on 14 Jul 2007 16:16
Final ChopClose added based on similarity with "1wmrA"
