CATH Domain: 1wzvA00 XML data for domain: 1wzvA00

Molscript image for 1wzvA00
1wzvA00
PDB coordinates for domain 1wzvA00

PDB 1wzv, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.110 Ubiquitin Conjugating Enzyme
3.10.110.10 Ubiquitin Conjugating Enzyme Gene3D
3.10.110.10.8
3.10.110.10.8.1
3.10.110.10.8.1.1
3.10.110.10.8.1.1.1
3.10.110.10.8.1.1.1.1

Segment boundaries for domain 1wzvA00

Chopping figure for domain 1wzvA00
DomainStart PDB ResidueStop PDB Residue
1wzvA00 2 151

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.10.110.10.8.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1br7003 85.15 3.10.110.10 117 35 76 1.48 1.93
1s1qA00 78.01 EndocytosisMultivesicular bodyPlasma membraneNucleolusTumor susceptibility gene 101 protein 3.10.110.10 137 13 73 3.66 4.99
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|1wzvA00
ASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDEN
GQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP    

Domain COMBS Sequence

>pdb|1wzvA00
GSHMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPN
VDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS    

Domain History Events (11)

Domain assigned by auto on 01 Nov 2006 18:16

Assigning to "3.10.110.10" based on similarity with "1wzwA00"

Flow stage update by auto on 01 Nov 2006 18:04

No in_process hits for Domain "1wzvA00" ready to be processed

Update comment by auto on 01 Nov 2006 14:27

Domain "1wzvA00" hits Domain "1wzwA00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "1wzvA00" hits Domain "1wzwA00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:49

Domain "1wzvA00" hits Domain "1wzwA00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "1wzvA00" hits Domain "1wzwA00" (100% over 100%) which is currently in process

Flow stage update by auto on 31 Oct 2006 05:52

Domain "1wzvA00" hits Domain "1wzwA00" (100% over 100%) which is currently in process

Flow stage update by auto on 31 Oct 2006 05:52

NW result present for Domain "1wzvA00"

Flow stage update by auto on 28 Oct 2006 13:45

All required files are present for Domain "1wzvA00"

Flow stage update by auto on 27 Oct 2006 14:53

Beginning processing for Domain "1wzvA00"

Insertion by auto on 27 Oct 2006 14:25

Final ChopClose added based on similarity with "1wzvB"