CATH Domain: 1wzdA00 XML data for domain: 1wzdA00

Molscript image for 1wzdA00
1wzdA00
PDB coordinates for domain 1wzdA00

PDB 1wzd, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.910 Heme Oxygenase; Chain A
1.20.910.10 Heme Oxygenase; Chain A Gene3D
1.20.910.10.1
1.20.910.10.1.1
1.20.910.10.1.1.1
1.20.910.10.1.1.1.1
1.20.910.10.1.1.1.1.1

[top]
Segment boundaries for domain 1wzdA00

Chopping figure for domain 1wzdA00
DomainStart PDB ResidueStop PDB Residue
1wzdA00 7 215

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 1.20.910.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1j02A00 91.38 DNA damage response, signal transduction resulting in induction of apoptosisRattus norvegicusRegulation of blood pressureNucleolusResponse to hydrogen peroxide 1.20.910.10 212 33 97 1.46 1.50
1n45A00 90.96 Positive regulation of smooth muscle cell proliferationPositive regulation of chemokine biosynthetic processSmooth muscle hyperplasiaProtein homooligomerizationErythrocyte homeostasis 1.20.910.10 214 34 96 1.53 1.58
1sk7A00 84.77 Pseudomonas aeruginosaHeme oxygenaseHeme oxygenase 1.20.910.10 187 14 87 2.41 2.75
1j77A00 84.02 Heme oxygenaseHemONeisseria meningitidis 1.20.910.10 199 13 88 2.77 3.15
1uddA00 82.08 Thiamine metabolismPyrococcus horikoshiiTranscriptional activator TenA [EC:3.5.99.2]218aa long hypothetical transcriptional regulator 1.20.910.10 215 11 94 3.64 3.86
2qcxA00 81.72 Thiamine metabolismBacillus subtilisThiaminase-2Transcriptional activator TenA [EC:3.5.99.2] 1.20.910.10 222 12 91 3.63 3.95
1z72A00 81.39 Putative transcriptional regulatorStreptococcus pneumoniae 1.20.910.10 213 11 91 3.61 3.96
1rtwB00 81.16 Pyrococcus furiosusTranscriptional activator, putative 1.20.910.10 204 9 95 3.58 3.74
2qzcA00 80.45 Sulfolobus solfataricusTranscriptional activator (TenA-1) 1.20.910.10 187 13 84 3.53 4.19
2f2gA00 80.13 Seed maturation protein PM36 homologArabidopsis thaliana 1.20.910.10 211 10 95 4.19 4.40
3bjdA02 79.99 Pseudomonas aeruginosaPutative uncharacterized protein 1.20.910.10 217 10 88 3.86 4.39
1rcwB00 79.73 Chlamydia trachomatisPqqC-like proteinPyrroloquinoline-quinone synthase [EC:1.3.3.11] 1.20.910.10 210 13 92 3.61 3.91
3hlxA00 76.02 Pyrroloquinoline-quinone synthase [EC:1.3.3.11]Klebsiella pneumoniae subsp. pneumoniae MGH 78578Pyrroloquinoline-quinone synthase 1.20.910.10 247 11 79 3.54 4.46
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wzdA00
GLAVELKQSTAQAHEKAEHSTFMSDLLKGRLGVAEFTRLQEQAWLFYTALEQAVDAVRASGFAESLLDPALNRAEVLARD
LDKLNGSSEWRSRITASPAVIDYVNRLEEIRDNVDGPALVAHHYVRYLGDLSGGQVIARMMQRHYGVDPEALGFYHFEGI
AKLKVYKDEYREKLNNLELSDEQREHLLKEATDAFVFNHQVFADLGKGL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wzdA00
MTTATAGLAVELKQSTAQAHEKAEHSTFMSDLLKGRLGVAEFTRLQEQAWLFYTALEQAVDAVRASGFAESLLDPALNRA
EVLARDLDKLNGSSEWRSRITASPAVIDYVNRLEEIRDNVDGPALVAHHYVRYLGDLSGGQVIARMMQRHYGVDPEALGF
YHFEGIAKLKVYKDEYREKLNNLELSDEQREHLLKEATDAFVFNHQVFADLGKGL
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:04

Assigning to "1.20.910.10" based on similarity with "1iw1A00" (NWSI: 100, NWO: 100, SPS: 97.36, SPO: 97, RMSD: 0.43)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "1wzdA00"

Flow stage update by auto on 28 Apr 2006 17:48

All required files are present for Domain "1wzdA00"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "1wzdA00"

Insertion by auto on 17 Mar 2006 18:40

Final ChopClose added based on similarity with "1iw0A" [LEE: 2, LME: 0, MR: 0, LG: 2, SS: 97.36, SI: 100, SO: 100]