CATH Domain: 1wz9A01 XML data for domain: 1wz9A01

Molscript image for 1wz9A01
1wz9A01
PDB coordinates for domain 1wz9A01

PDB 1wz9, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.497 Antithrombin; Chain I, domain 2
3.30.497.10 Antithrombin, subunit I, domain 2 Gene3D
3.30.497.10.8
3.30.497.10.8.1
3.30.497.10.8.1.1
3.30.497.10.8.1.1.1
3.30.497.10.8.1.1.1.1

[top]
Segment boundaries for domain 1wz9A01

Chopping figure for domain 1wz9A01
DomainStart PDB ResidueStop PDB Residue
1wz9A01 1 169
1wz9A01 276 327
1wz9A02 170 275
1wz9A02 328 375

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.497.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1k9oI01 86.67 Manduca sextaAlaserpinProtein binding 3.30.497.10 215 22 94 2.37 2.50
1imvA02 86.32 Negative regulation of angiogenesisHomo sapiensPigment epithelium-derived factorPositive regulation of neurogenesisCell proliferation 3.30.497.10 206 22 91 1.99 2.17
2b5tI01 86.17 Antithrombin IIIProtease bindingHomo sapiensAntithrombin-IIIExtracellular space 3.30.497.10 259 26 84 1.92 2.27
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wz9A01
MDALQLANSAFAVDLFKQLEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLS
SFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILV
VNAAYFVGFKVEKMIDPKACLENLGLKHIFSEDTSDFSGMSETKGVALSNVIHKVLEIT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wz9A01
MDALQLANSAFAVDLFKQLXEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKL
SSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKIL
VVNAAYFVGFKVEKMIDPKACLENLGLKHIFSEDTSDFSGMSETKGVALSNVIHKVXLEIT
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:03

Assigning to "3.30.497.10" based on similarity with "1wz9B01" (NWSI: 99.0950226244344, NWO: 100, SPS: 96.94, SPO: 99, RMSD: 0.42)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "1wz9A01"

Flow stage update by auto on 28 Apr 2006 17:48

All required files are present for Domain "1wz9A01"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "1wz9A01"

Insertion by auto on 10 Mar 2006 06:17

Final ChopClose added based on similarity with "1wz9B" [LEE: 0, LME: 0, MR: 0, LG: 4, SS: 95.60, SI: 98.4, SO: 100]