Domain assigned by auto on 28 Apr 2006 21:00
Assigning to "3.10.20.90" based on similarity with "1tgzB00" (NWSI: 100, NWO: 98.75, SPS: 94.67, SPO: 98, RMSD: 1.72)
There are 37 matching structural neighberhood comparisons for CATH ID 3.10.20.90.14.1.1.1.1 (SIMAX score < 5)
>pdb|1wywB00 GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Assigning to "3.10.20.90" based on similarity with "1tgzB00" (NWSI: 100, NWO: 98.75, SPS: 94.67, SPO: 98, RMSD: 1.72)
NW result present for Domain "1wywB00"
All required files are present for Domain "1wywB00"
Beginning processing for Domain "1wywB00"